DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42346 and trn

DIOPT Version :10

Sequence 1:NP_001036303.2 Gene:CG42346 / 3355160 FlyBaseID:FBgn0259677 Length:1817 Species:Drosophila melanogaster
Sequence 2:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster


Alignment Length:651 Identity:160/651 - (24%)
Similarity:270/651 - (41%) Gaps:120/651 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   580 NVDVIYLESNAIAHIDPNV--FSTLVNLDHLYLRSNFIPLLPVTLFDKSTKLTSLSLDNNEIQDL 642
            ::..:.::||.|..||.::  ::.|..||   |.||.:..:|...|....||..:.|::|:|..:
  Fly    60 SIQRLVIKSNKIKTIDSSIQFYAELTFLD---LSSNHLMTIPQRTFAYQKKLQEVHLNHNKIGQI 121

  Fly   643 EIGMFRKLEHLREVRLHNNRIRRVRRGVFEPLPSLQELHIQKNSIEDIEPQAFHTLENMQHINLQ 707
            ....|..|..:..:.|..|:|..:.:|.|.||..::||::.:|.|..::|:||..|..::.:.|.
  Fly   122 SNKTFIGLSAVTVLNLRGNQISELHQGTFTPLLKIEELNLGENRIGYLDPKAFDGLSQLRILYLD 186

  Fly   708 DNQLTVLEDIFPDENSSLLSVQLEANYLHKVHPRTFSRQQKVQIMWLKDNQLTRVERSFFADTPQ 772
            ||.||.:.|                       |..|.....:..::|..|.|..::...|.|...
  Fly   187 DNALTTVPD-----------------------PVIFQAMPSLAELFLGMNTLQSIQADAFQDLKG 228

  Fly   773 LGRLYLSDNKIRDIEKDTFVNLLLLQFLDLSGNQLRQLRRDYFAPLQDLEELSLARNHIEAIEGY 837
            |.||.|....:|:|..|:|:.|..|:.||||.|:|.::.....:.|..||:|||.:|..|.|...
  Fly   229 LTRLELKGASLRNISHDSFLGLQELRILDLSDNRLDRIPSVGLSKLVRLEQLSLGQNDFEVISEG 293

  Fly   838 AFAKLKNLKSLDLSHNPLVQLTR---DIFSNEFPLNSLNL-GNCSLRKLEQHAFKSLTNLNELNL 898
            ||..||.||.|::  |..::|.|   ..||:...|..||| .|..|.::::.|...|:.|..:.|
  Fly   294 AFMGLKQLKRLEV--NGALRLKRVMTGAFSDNGNLEYLNLSSNKMLLEVQEGALSGLSQLKHVVL 356

  Fly   899 ERNQLNP--------ADIQTLDIPN-----------LRRLLLSHNNFSYAGSVGIMAGMLDRLR- 943
            :.|.|..        .|:||||:..           |..||:: .|.|......::....:||| 
  Fly   357 KANALTSLAEGLFPWKDLQTLDLSENPLSCDCRVMWLHNLLVA-KNASQDDVSELLCEFPERLRG 420

  Fly   944 -SLQQL--SMSNCSLGQ------IPDLLFAKNTNLVRLDL----CDNRLTQ-INRNIFSGLNVFK 994
             ||:.|  :|..|:...      |..||......:..|.|    |.:::.: |...::....:.:
  Fly   421 ESLRHLNPAMMGCTHADPRKQALIGALLVGSAATITALALVLYRCRHKIRETIKGGLWGNSALGR 485

  Fly   995 ELR-----LCRNEL--------------SDFP--HIALYNLSTLESLDLAR---NQLASID---- 1031
            :.|     .|..:.              |.||  :.|.::........:..   |.|.:||    
  Fly   486 KEREYQKTFCDEDYMSRHQHHPCSLGIHSTFPNTYTAPHHPGATHHYGMCPMPVNDLGAIDPQQK 550

  Fly  1032 FFKL---SGTLNLRQLILRDNKITALSGFNAVNLTQLDSVDLSGNLLLSLPANFLR---HSINLQ 1090
            |.:|   :.|: :.:..|.:||.....|          ::|.|.:.:|.:.:..:.   |..|.|
  Fly   551 FQQLVVPTATM-ISEKKLNNNKALVSQG----------AIDDSASFVLHMKSATMGRDVHQQNPQ 604

  Fly  1091 KVHLSNNRFLQ----IPSSALSDVSIPRLSWLNLTGNPINRIYTVKEERYPYLKELYICQTNLSI 1151
            ..|.:..:||.    :..|..|...:|.:....| |.|......:.:|.:.. :|||..:....|
  Fly   605 LNHYTKPQFLSATATVGDSCYSYADVPMVHGAPL-GGPNQPQLRLTQEHFKQ-RELYDQEMGSEI 667

  Fly  1152 L 1152
            |
  Fly   668 L 668

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42346NP_001036303.2 LRR <301..606 CDD:443914 6/27 (22%)
leucine-rich repeat 303..325 CDD:275380
leucine-rich repeat 327..350 CDD:275380
leucine-rich repeat 351..461 CDD:275380
leucine-rich repeat 399..422 CDD:275380
leucine-rich repeat 462..485 CDD:275380
LRR 486..>736 CDD:443914 41/157 (26%)
leucine-rich repeat 486..509 CDD:275380
leucine-rich repeat 510..533 CDD:275380
leucine-rich repeat 534..556 CDD:275380
leucine-rich repeat 557..580 CDD:275380 160/651 (25%)
leucine-rich repeat 581..604 CDD:275380 6/24 (25%)
leucine-rich repeat 605..628 CDD:275380 7/22 (32%)
PPP1R42 627..860 CDD:455733 69/232 (30%)
leucine-rich repeat 629..652 CDD:275380 6/22 (27%)
leucine-rich repeat 653..676 CDD:275380 7/22 (32%)
leucine-rich repeat 677..700 CDD:275380 8/22 (36%)
leucine-rich repeat 701..748 CDD:275380 8/46 (17%)
leucine-rich repeat 725..736 CDD:275378 0/10 (0%)
leucine-rich repeat 749..772 CDD:275380 5/22 (23%)
leucine-rich repeat 773..793 CDD:275380 8/19 (42%)
leucine-rich repeat 821..844 CDD:275380 11/22 (50%)
leucine-rich repeat 845..868 CDD:275380 8/25 (32%)
LRR 869..1226 CDD:443914 75/357 (21%)
leucine-rich repeat 869..892 CDD:275380 8/23 (35%)
leucine-rich repeat 893..915 CDD:275380 9/29 (31%)
leucine-rich repeat 916..944 CDD:275380 8/29 (28%)
leucine-rich repeat 945..968 CDD:275380 7/30 (23%)
leucine-rich repeat 969..992 CDD:275380 4/27 (15%)
leucine-rich repeat 993..1014 CDD:275380 6/41 (15%)
leucine-rich repeat 1017..1040 CDD:275380 7/32 (22%)
leucine-rich repeat 1041..1064 CDD:275380 4/22 (18%)
leucine-rich repeat 1089..1114 CDD:275380 6/28 (21%)
leucine-rich repeat 1115..1162 CDD:275380 9/38 (24%)
PPP1R42 1155..1317 CDD:455733
leucine-rich repeat 1163..1186 CDD:275380
leucine-rich repeat 1187..1210 CDD:275380
leucine-rich repeat 1211..1233 CDD:275380
leucine-rich repeat 1234..1257 CDD:275380
leucine-rich repeat 1258..1279 CDD:275380
leucine-rich repeat 1282..1306 CDD:275380
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 5/17 (29%)
LRR 82..406 CDD:443914 102/352 (29%)
leucine-rich repeat 84..107 CDD:275380 8/25 (32%)
leucine-rich repeat 108..131 CDD:275380 6/22 (27%)
leucine-rich repeat 132..155 CDD:275380 7/22 (32%)
leucine-rich repeat 156..179 CDD:275380 8/22 (36%)
leucine-rich repeat 180..204 CDD:275380 8/46 (17%)
leucine-rich repeat 205..228 CDD:275380 5/22 (23%)
leucine-rich repeat 229..252 CDD:275380 9/22 (41%)
leucine-rich repeat 253..276 CDD:275380 8/22 (36%)
leucine-rich repeat 277..300 CDD:275380 11/22 (50%)
leucine-rich repeat 301..322 CDD:275380 7/22 (32%)
leucine-rich repeat 326..350 CDD:275380 8/23 (35%)
leucine-rich repeat 351..373 CDD:275380 4/21 (19%)
LRRCT 382..434 CDD:214507 12/52 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.