DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42346 and trn

DIOPT Version :9

Sequence 1:NP_001036303.2 Gene:CG42346 / 3355160 FlyBaseID:FBgn0259677 Length:1817 Species:Drosophila melanogaster
Sequence 2:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster


Alignment Length:651 Identity:160/651 - (24%)
Similarity:270/651 - (41%) Gaps:120/651 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   580 NVDVIYLESNAIAHIDPNV--FSTLVNLDHLYLRSNFIPLLPVTLFDKSTKLTSLSLDNNEIQDL 642
            ::..:.::||.|..||.::  ::.|..||   |.||.:..:|...|....||..:.|::|:|..:
  Fly    60 SIQRLVIKSNKIKTIDSSIQFYAELTFLD---LSSNHLMTIPQRTFAYQKKLQEVHLNHNKIGQI 121

  Fly   643 EIGMFRKLEHLREVRLHNNRIRRVRRGVFEPLPSLQELHIQKNSIEDIEPQAFHTLENMQHINLQ 707
            ....|..|..:..:.|..|:|..:.:|.|.||..::||::.:|.|..::|:||..|..::.:.|.
  Fly   122 SNKTFIGLSAVTVLNLRGNQISELHQGTFTPLLKIEELNLGENRIGYLDPKAFDGLSQLRILYLD 186

  Fly   708 DNQLTVLEDIFPDENSSLLSVQLEANYLHKVHPRTFSRQQKVQIMWLKDNQLTRVERSFFADTPQ 772
            ||.||.:.|                       |..|.....:..::|..|.|..::...|.|...
  Fly   187 DNALTTVPD-----------------------PVIFQAMPSLAELFLGMNTLQSIQADAFQDLKG 228

  Fly   773 LGRLYLSDNKIRDIEKDTFVNLLLLQFLDLSGNQLRQLRRDYFAPLQDLEELSLARNHIEAIEGY 837
            |.||.|....:|:|..|:|:.|..|:.||||.|:|.::.....:.|..||:|||.:|..|.|...
  Fly   229 LTRLELKGASLRNISHDSFLGLQELRILDLSDNRLDRIPSVGLSKLVRLEQLSLGQNDFEVISEG 293

  Fly   838 AFAKLKNLKSLDLSHNPLVQLTR---DIFSNEFPLNSLNL-GNCSLRKLEQHAFKSLTNLNELNL 898
            ||..||.||.|::  |..::|.|   ..||:...|..||| .|..|.::::.|...|:.|..:.|
  Fly   294 AFMGLKQLKRLEV--NGALRLKRVMTGAFSDNGNLEYLNLSSNKMLLEVQEGALSGLSQLKHVVL 356

  Fly   899 ERNQLNP--------ADIQTLDIPN-----------LRRLLLSHNNFSYAGSVGIMAGMLDRLR- 943
            :.|.|..        .|:||||:..           |..||:: .|.|......::....:||| 
  Fly   357 KANALTSLAEGLFPWKDLQTLDLSENPLSCDCRVMWLHNLLVA-KNASQDDVSELLCEFPERLRG 420

  Fly   944 -SLQQL--SMSNCSLGQ------IPDLLFAKNTNLVRLDL----CDNRLTQ-INRNIFSGLNVFK 994
             ||:.|  :|..|:...      |..||......:..|.|    |.:::.: |...::....:.:
  Fly   421 ESLRHLNPAMMGCTHADPRKQALIGALLVGSAATITALALVLYRCRHKIRETIKGGLWGNSALGR 485

  Fly   995 ELR-----LCRNEL--------------SDFP--HIALYNLSTLESLDLAR---NQLASID---- 1031
            :.|     .|..:.              |.||  :.|.::........:..   |.|.:||    
  Fly   486 KEREYQKTFCDEDYMSRHQHHPCSLGIHSTFPNTYTAPHHPGATHHYGMCPMPVNDLGAIDPQQK 550

  Fly  1032 FFKL---SGTLNLRQLILRDNKITALSGFNAVNLTQLDSVDLSGNLLLSLPANFLR---HSINLQ 1090
            |.:|   :.|: :.:..|.:||.....|          ::|.|.:.:|.:.:..:.   |..|.|
  Fly   551 FQQLVVPTATM-ISEKKLNNNKALVSQG----------AIDDSASFVLHMKSATMGRDVHQQNPQ 604

  Fly  1091 KVHLSNNRFLQ----IPSSALSDVSIPRLSWLNLTGNPINRIYTVKEERYPYLKELYICQTNLSI 1151
            ..|.:..:||.    :..|..|...:|.:....| |.|......:.:|.:.. :|||..:....|
  Fly   605 LNHYTKPQFLSATATVGDSCYSYADVPMVHGAPL-GGPNQPQLRLTQEHFKQ-RELYDQEMGSEI 667

  Fly  1152 L 1152
            |
  Fly   668 L 668

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42346NP_001036303.2 leucine-rich repeat 303..325 CDD:275380
LRR_8 325..384 CDD:290566
leucine-rich repeat 327..350 CDD:275380
leucine-rich repeat 351..461 CDD:275380
LRR_8 373..433 CDD:290566
LRR_RI 397..648 CDD:238064 18/69 (26%)
leucine-rich repeat 399..422 CDD:275380
leucine-rich repeat 462..485 CDD:275380
LRR_8 465..520 CDD:290566
leucine-rich repeat 486..509 CDD:275380
LRR_8 508..567 CDD:290566
leucine-rich repeat 510..533 CDD:275380
LRR_RI 527..785 CDD:238064 52/206 (25%)
leucine-rich repeat 534..556 CDD:275380
LRR_8 555..613 CDD:290566 9/34 (26%)
leucine-rich repeat 557..580 CDD:275380 160/651 (25%)
leucine-rich repeat 581..604 CDD:275380 6/24 (25%)
LRR_8 604..663 CDD:290566 16/58 (28%)
leucine-rich repeat 605..628 CDD:275380 7/22 (32%)
leucine-rich repeat 629..652 CDD:275380 6/22 (27%)
LRR_8 652..711 CDD:290566 18/58 (31%)
leucine-rich repeat 653..676 CDD:275380 7/22 (32%)
leucine-rich repeat 677..700 CDD:275380 8/22 (36%)
leucine-rich repeat 701..748 CDD:275380 8/46 (17%)
leucine-rich repeat 725..736 CDD:275378 0/10 (0%)
leucine-rich repeat 749..772 CDD:275380 5/22 (23%)
LRR_8 771..831 CDD:290566 23/59 (39%)
leucine-rich repeat 773..793 CDD:275380 8/19 (42%)
LRR_RI 804..1076 CDD:238064 79/340 (23%)
LRR_8 821..903 CDD:290566 31/85 (36%)
leucine-rich repeat 821..844 CDD:275380 11/22 (50%)
leucine-rich repeat 845..868 CDD:275380 8/25 (32%)
leucine-rich repeat 869..892 CDD:275380 8/23 (35%)
leucine-rich repeat 893..915 CDD:275380 9/29 (31%)
leucine-rich repeat 916..944 CDD:275380 8/29 (28%)
leucine-rich repeat 945..968 CDD:275380 7/30 (23%)
LRR_8 967..1027 CDD:290566 11/88 (13%)
leucine-rich repeat 969..992 CDD:275380 4/27 (15%)
leucine-rich repeat 993..1014 CDD:275380 6/41 (15%)
LRR_8 1015..1075 CDD:290566 13/69 (19%)
leucine-rich repeat 1017..1040 CDD:275380 7/32 (22%)
leucine-rich repeat 1041..1064 CDD:275380 4/22 (18%)
LRR_RI <1047..1244 CDD:238064 24/113 (21%)
LRR_8 1063..1125 CDD:290566 14/68 (21%)
leucine-rich repeat 1089..1114 CDD:275380 6/28 (21%)
leucine-rich repeat 1115..1162 CDD:275380 9/38 (24%)
LRR_8 1163..1219 CDD:290566
leucine-rich repeat 1163..1186 CDD:275380
leucine-rich repeat 1187..1210 CDD:275380
leucine-rich repeat 1211..1233 CDD:275380
leucine-rich repeat 1234..1257 CDD:275380
LRR_8 1235..1292 CDD:290566
leucine-rich repeat 1258..1279 CDD:275380
leucine-rich repeat 1282..1306 CDD:275380
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 5/17 (29%)
LRR_8 83..142 CDD:290566 17/61 (28%)
leucine-rich repeat 84..107 CDD:275380 8/25 (32%)
leucine-rich repeat 108..131 CDD:275380 6/22 (27%)
LRR_RI 129..421 CDD:238064 91/317 (29%)
LRR_8 132..190 CDD:290566 18/57 (32%)
leucine-rich repeat 132..155 CDD:275380 7/22 (32%)
leucine-rich repeat 156..179 CDD:275380 8/22 (36%)
leucine-rich repeat 180..204 CDD:275380 8/46 (17%)
LRR_8 203..263 CDD:290566 20/59 (34%)
leucine-rich repeat 205..228 CDD:275380 5/22 (23%)
leucine-rich repeat 229..252 CDD:275380 9/22 (41%)
LRR_8 252..308 CDD:290566 23/57 (40%)
leucine-rich repeat 253..276 CDD:275380 8/22 (36%)
leucine-rich repeat 277..300 CDD:275380 11/22 (50%)
leucine-rich repeat 301..322 CDD:275380 7/22 (32%)
LRR_8 325..384 CDD:290566 17/58 (29%)
leucine-rich repeat 326..350 CDD:275380 8/23 (35%)
leucine-rich repeat 351..373 CDD:275380 4/21 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453517
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.