DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42346 and CG42709

DIOPT Version :9

Sequence 1:NP_001036303.2 Gene:CG42346 / 3355160 FlyBaseID:FBgn0259677 Length:1817 Species:Drosophila melanogaster
Sequence 2:NP_001163434.1 Gene:CG42709 / 39453 FlyBaseID:FBgn0261674 Length:458 Species:Drosophila melanogaster


Alignment Length:293 Identity:75/293 - (25%)
Similarity:114/293 - (38%) Gaps:50/293 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 DFDYNEIVRVDDYSFYGLRISKLNMKGNRLQGMPEHAFAGLEECMQEIDVSENGLRTF-PLMAL- 417
            ||:|.:    ||||.............|||  ||:.:             |.:...|| |:..: 
  Fly    37 DFNYGD----DDYSETATGEESPETAENRL--MPQSS-------------STSTTTTFRPIFNIP 82

  Fly   418 RKLDHLRILRLSNNRIPTFYGDIQLATNNASAAAAAVGAFQLPSLIFLDLSSNQFAEIGPDCFRA 482
            |:.:|  :|..|..|......|.:. ...|:|....|......:...:|||.|..||:.|:.|..
  Fly    83 RRSNH--VLEPSCPRNCLCLEDFKF-VQCANAHLTHVPLDMPKTAAIIDLSHNVIAELRPEDFAN 144

  Fly   483 FPQLKTLSFYANQIELVQPEAFKSLRELMSLDMSHNRIIGLDPKVFEKNKRLQTVDLSHNHI-HT 546
            ..:...::...|.|..:..:.|:....|..|.:::||:..:||..|...|.|..:|||:|.| ..
  Fly   145 LSRAVEINLNHNLISSIDKDVFQGSERLKRLRLANNRLTKIDPDTFAAAKELTLLDLSNNTITQR 209

  Fly   547 IGGVFSNLPQLREVFLSENNILELPADAFTNSTNVDVIYLESNAI-AHIDPNVFSTLVNLDHLYL 610
            :.|.|.|.|.|.|......:..|||...|.|.:.::|:.|..|.. ..|:...||.|        
  Fly   210 LDGSFLNQPDLVEFSCVNCSWTELPEQTFQNMSGLEVLRLNKNDFKQQINTKAFSPL-------- 266

  Fly   611 RSNFIPLLPVTLFDKSTKLTSLSLDNNEIQDLE 643
                            ||:..|.|...|.|::|
  Fly   267 ----------------TKIIKLKLPELEQQNIE 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42346NP_001036303.2 leucine-rich repeat 303..325 CDD:275380
LRR_8 325..384 CDD:290566 8/28 (29%)
leucine-rich repeat 327..350 CDD:275380
leucine-rich repeat 351..461 CDD:275380 25/107 (23%)
LRR_8 373..433 CDD:290566 13/61 (21%)
LRR_RI 397..648 CDD:238064 63/251 (25%)
leucine-rich repeat 399..422 CDD:275380 5/24 (21%)
leucine-rich repeat 462..485 CDD:275380 8/22 (36%)
LRR_8 465..520 CDD:290566 14/54 (26%)
leucine-rich repeat 486..509 CDD:275380 3/22 (14%)
LRR_8 508..567 CDD:290566 20/59 (34%)
leucine-rich repeat 510..533 CDD:275380 7/22 (32%)
LRR_RI 527..785 CDD:238064 33/119 (28%)
leucine-rich repeat 534..556 CDD:275380 9/22 (41%)
LRR_8 555..613 CDD:290566 15/58 (26%)
leucine-rich repeat 557..580 CDD:275380 7/22 (32%)
leucine-rich repeat 581..604 CDD:275380 7/23 (30%)
LRR_8 604..663 CDD:290566 7/40 (18%)
leucine-rich repeat 605..628 CDD:275380 0/22 (0%)
leucine-rich repeat 629..652 CDD:275380 5/15 (33%)
LRR_8 652..711 CDD:290566
leucine-rich repeat 653..676 CDD:275380
leucine-rich repeat 677..700 CDD:275380
leucine-rich repeat 701..748 CDD:275380
leucine-rich repeat 725..736 CDD:275378
leucine-rich repeat 749..772 CDD:275380
LRR_8 771..831 CDD:290566
leucine-rich repeat 773..793 CDD:275380
LRR_RI 804..1076 CDD:238064
LRR_8 821..903 CDD:290566
leucine-rich repeat 821..844 CDD:275380
leucine-rich repeat 845..868 CDD:275380
leucine-rich repeat 869..892 CDD:275380
leucine-rich repeat 893..915 CDD:275380
leucine-rich repeat 916..944 CDD:275380
leucine-rich repeat 945..968 CDD:275380
LRR_8 967..1027 CDD:290566
leucine-rich repeat 969..992 CDD:275380
leucine-rich repeat 993..1014 CDD:275380
LRR_8 1015..1075 CDD:290566
leucine-rich repeat 1017..1040 CDD:275380
leucine-rich repeat 1041..1064 CDD:275380
LRR_RI <1047..1244 CDD:238064
LRR_8 1063..1125 CDD:290566
leucine-rich repeat 1089..1114 CDD:275380
leucine-rich repeat 1115..1162 CDD:275380
LRR_8 1163..1219 CDD:290566
leucine-rich repeat 1163..1186 CDD:275380
leucine-rich repeat 1187..1210 CDD:275380
leucine-rich repeat 1211..1233 CDD:275380
leucine-rich repeat 1234..1257 CDD:275380
LRR_8 1235..1292 CDD:290566
leucine-rich repeat 1258..1279 CDD:275380
leucine-rich repeat 1282..1306 CDD:275380
CG42709NP_001163434.1 LRR_8 126..182 CDD:290566 14/55 (25%)
leucine-rich repeat 128..147 CDD:275380 8/18 (44%)
leucine-rich repeat 148..171 CDD:275380 3/22 (14%)
LRR_RI <150..225 CDD:238064 23/74 (31%)
LRR_8 171..254 CDD:290566 28/82 (34%)
leucine-rich repeat 172..195 CDD:275380 7/22 (32%)
leucine-rich repeat 196..219 CDD:275380 9/22 (41%)
leucine-rich repeat 220..243 CDD:275380 7/22 (32%)
leucine-rich repeat 244..268 CDD:275380 7/47 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453695
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.