DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42346 and Gp150

DIOPT Version :9

Sequence 1:NP_001036303.2 Gene:CG42346 / 3355160 FlyBaseID:FBgn0259677 Length:1817 Species:Drosophila melanogaster
Sequence 2:NP_477049.2 Gene:Gp150 / 37549 FlyBaseID:FBgn0013272 Length:1076 Species:Drosophila melanogaster


Alignment Length:908 Identity:203/908 - (22%)
Similarity:351/908 - (38%) Gaps:220/908 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 SFDNTACPCYKF--EDGLFLECPGTTAISLRSTLERISAP-IHSLSIYDFDRSVT---------- 289
            |..||..|...|  :|....|......:|...:|.:||.| :..|.:....||.|          
  Fly    48 SHSNTVGPKIHFIHDDLTENELNSGEEVSPTESLPKISTPKVKDLPVETTTRSPTKKTTSSGTEK 112

  Fly   290 SLSQDVFQPGVHIRHLQFSHSHLEALKDN------------------------------------ 318
            |||::.:      ..|..:..|.:||.|:                                    
  Fly   113 SLSEEAW------NDLMEAAKHSQALADDPHFNKMLNTTVAAGEKNSTDTDDSEYYDYDDDYNYF 171

  Fly   319 ---------SLRNVRSSLESLSIVNGKLTQMPSRALSSMQKLTALD------FDYNEIVRVDDYS 368
                     |.:..:|:.:...||:..:|:..|::.....|.:|.|      :||:|        
  Fly   172 DEETVTISPSPKKAKSNPKLQPIVDATITKSKSKSNDQKTKESANDIDSDSQYDYDE-------- 228

  Fly   369 FYGLRISKLNMKGNRLQGMPEHAFAGLEECMQEIDVSENGLRTFPLMALRKLDHLRILRLSNNRI 433
                                     ||::...|.|.:::.|          .|..:::...:...
  Fly   229 -------------------------GLDDDDDEDDAADDLL----------TDDEQVVFSEDVPC 258

  Fly   434 PTFYGDIQLATNNASAAAAAVGAFQLPSLIFLDLSSNQF---------AEIGPDCFRAFPQLKTL 489
            |.|   .|.|.|        |.::.:.:...||:...:|         ..:||    .:|.|...
  Fly   259 PRF---CQCARN--------VNSYLVATCSRLDMGIQKFGSDITDLVVTNVGP----KYPILMGP 308

  Fly   490 SFYAN--------------QIELVQPEAFKSLRELMSLDMSHNRIIGLDPKVFEKNKRLQTVDLS 540
            :|:.|              .:|.:..|||..|.||.:::::...:..::|..|..||:|:.:.:|
  Fly   309 NFFQNLGLKNVASIKIANCTLEYLHAEAFHGLNELYAVNLTDVGLAIINPDTFVGNKKLRMLTIS 373

  Fly   541 HNHIHTIGGVFSNL--PQLREVFLSENNILELPADAFTNSTNVDVIYLESNAIAHIDPNVFSTLV 603
            .|.:..:..:...|  ..:.|:..|.||::||...||::.:||..|.|..|::..:....|..:.
  Fly   374 GNDLSVMSSIHYLLKSSSIEELDFSRNNLMELNPKAFSHLSNVVYINLSQNSLKKLPEKAFEKVT 438

  Fly   604 NLDHLYLRSNFIPLLPVTLFDKSTKLTSLSLDNNEIQ-DLEIGMFRKLEHLREVRLHNNRIRRVR 667
            .|:.|.|..|.:..||..:|: .|.|:.|.|..|... ||..|    .:.|:::.|..|.|.:|.
  Fly   439 LLEELDLSYNSLTELPRDIFN-GTTLSILHLKYNTFNGDLHFG----TKDLQQLDLSFNSIVQVH 498

  Fly   668 RGVFEPLPSLQELHIQKNSIEDIEPQAFHTLENMQHINLQDNQLTVLEDIFPDENSSLLSVQLEA 732
            ..:|:.:|.|..|:::.|.|:.|:|.:|.||:|::||:|..|.|..:..:...:||.|..::|..
  Fly   499 HSMFDKMPGLTNLNLKGNGIKKIQPDSFLTLKNLRHIDLSINDLDQISGMLFFKNSELDVIRLND 563

  Fly   733 NYLHKVHPR----------TFSRQQKVQIMWLKDNQLTRVERSFFADTPQLGRLYLSDNKIRDIE 787
            |      ||          ::|.:..|..:.:.:..:..:....|:..|.|..|.|:.|.|..:.
  Fly   564 N------PRLSQLPTDGFLSYSGEFTVYYLDISNCAIGPLGHKAFSTMPHLTTLKLAWNNINHLP 622

  Fly   788 KDTFVNLLLLQFLDLSGNQLRQLRRDYFAPLQDLEELSLARNHIEAIEGYAFAKLKNLKSLDLSH 852
            ::.|..|..|..||||.|.:.::....|....:|.:||||.|.|..:....|..|..|:.||::.
  Fly   623 REIFTGLHKLIDLDLSNNLITRMDDLIFMDNGELTKLSLAGNPISRLSVRLFLPLHQLRCLDVND 687

  Fly   853 NPLVQLTRD--------IFSNEFPLNSLNLGNCSLRKLEQHAFKSLTNLNELNLERNQLN-PADI 908
            ..|..|..|        ||.:   |.|.|.....::|:.....||..||..|::..|.|. ..|.
  Fly   688 CELTTLLSDRDLGAGYKIFDS---LRSFNASGNLIKKISSEDVKSFKNLRSLDITNNPLKCTPDF 749

  Fly   909 Q------TLDIPNLRRLLLSHNNFSYAGSVGIMAGMLD-----RLRSLQQLSMSN-----CSLGQ 957
            |      ||.:....:.|            .::|.:.|     :|.:|.|...|:     |...:
  Fly   750 QEFISYVTLQMQMTPKRL------------PVLANLEDDATIVQLETLAQAGWSSLAHEVCKHAE 802

  Fly   958 IPDLLFAKNTNLVRLDLCDNRLTQ----INRNIFSGLNVFKELRLCRNELSDFPHIALYNLST 1016
            ..|||..|..:.....| :.||.:    :|.:....|:|..:..|.::.||....|...:::|
  Fly   803 GSDLLDEKKADSAEAKL-EKRLKESVKKLNEDEAKLLSVLDKSVLDKSRLSSMQKIMKGSVNT 864

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42346NP_001036303.2 leucine-rich repeat 303..325 CDD:275380 6/66 (9%)
LRR_8 325..384 CDD:290566 11/64 (17%)
leucine-rich repeat 327..350 CDD:275380 4/22 (18%)
leucine-rich repeat 351..461 CDD:275380 17/115 (15%)
LRR_8 373..433 CDD:290566 6/59 (10%)
LRR_RI 397..648 CDD:238064 63/276 (23%)
leucine-rich repeat 399..422 CDD:275380 3/22 (14%)
leucine-rich repeat 462..485 CDD:275380 5/31 (16%)
LRR_8 465..520 CDD:290566 16/77 (21%)
leucine-rich repeat 486..509 CDD:275380 8/36 (22%)
LRR_8 508..567 CDD:290566 13/60 (22%)
leucine-rich repeat 510..533 CDD:275380 4/22 (18%)
LRR_RI 527..785 CDD:238064 74/270 (27%)
leucine-rich repeat 534..556 CDD:275380 4/23 (17%)
LRR_8 555..613 CDD:290566 17/57 (30%)
leucine-rich repeat 557..580 CDD:275380 8/22 (36%)
leucine-rich repeat 581..604 CDD:275380 5/22 (23%)
LRR_8 604..663 CDD:290566 18/59 (31%)
leucine-rich repeat 605..628 CDD:275380 7/22 (32%)
leucine-rich repeat 629..652 CDD:275380 7/23 (30%)
LRR_8 652..711 CDD:290566 21/58 (36%)
leucine-rich repeat 653..676 CDD:275380 6/22 (27%)
leucine-rich repeat 677..700 CDD:275380 9/22 (41%)
leucine-rich repeat 701..748 CDD:275380 13/56 (23%)
leucine-rich repeat 725..736 CDD:275378 3/10 (30%)
leucine-rich repeat 749..772 CDD:275380 2/22 (9%)
LRR_8 771..831 CDD:290566 21/59 (36%)
leucine-rich repeat 773..793 CDD:275380 6/19 (32%)
LRR_RI 804..1076 CDD:238064 57/242 (24%)
LRR_8 821..903 CDD:290566 27/89 (30%)
leucine-rich repeat 821..844 CDD:275380 9/22 (41%)
leucine-rich repeat 845..868 CDD:275380 8/30 (27%)
leucine-rich repeat 869..892 CDD:275380 6/22 (27%)
leucine-rich repeat 893..915 CDD:275380 8/28 (29%)
leucine-rich repeat 916..944 CDD:275380 4/32 (13%)
leucine-rich repeat 945..968 CDD:275380 8/27 (30%)
LRR_8 967..1027 CDD:290566 11/54 (20%)
leucine-rich repeat 969..992 CDD:275380 5/26 (19%)
leucine-rich repeat 993..1014 CDD:275380 4/20 (20%)
LRR_8 1015..1075 CDD:290566 1/2 (50%)
leucine-rich repeat 1017..1040 CDD:275380 203/908 (22%)
leucine-rich repeat 1041..1064 CDD:275380
LRR_RI <1047..1244 CDD:238064
LRR_8 1063..1125 CDD:290566
leucine-rich repeat 1089..1114 CDD:275380
leucine-rich repeat 1115..1162 CDD:275380
LRR_8 1163..1219 CDD:290566
leucine-rich repeat 1163..1186 CDD:275380
leucine-rich repeat 1187..1210 CDD:275380
leucine-rich repeat 1211..1233 CDD:275380
leucine-rich repeat 1234..1257 CDD:275380
LRR_8 1235..1292 CDD:290566
leucine-rich repeat 1258..1279 CDD:275380
leucine-rich repeat 1282..1306 CDD:275380
Gp150NP_477049.2 LRR_8 317..377 CDD:290566 14/59 (24%)
leucine-rich repeat 343..366 CDD:275380 4/22 (18%)
leucine-rich repeat 367..391 CDD:275380 4/23 (17%)
LRR_RI <374..619 CDD:238064 68/255 (27%)
LRR_8 390..450 CDD:290566 18/59 (31%)
leucine-rich repeat 393..415 CDD:275380 8/21 (38%)
leucine-rich repeat 416..439 CDD:275380 5/22 (23%)
leucine-rich repeat 440..483 CDD:275380 15/47 (32%)
leucine-rich repeat 463..481 CDD:275380 7/21 (33%)
LRR_8 484..542 CDD:290566 21/57 (37%)
leucine-rich repeat 484..507 CDD:275380 6/22 (27%)
leucine-rich repeat 508..531 CDD:275380 9/22 (41%)
leucine-rich repeat 532..569 CDD:275380 12/42 (29%)
leucine-rich repeat 556..583 CDD:275380 6/32 (19%)
leucine-rich repeat 570..607 CDD:275380 3/36 (8%)
LRR_RI <586..745 CDD:238064 44/161 (27%)
LRR_8 606..666 CDD:290566 21/59 (36%)
leucine-rich repeat 608..631 CDD:275380 7/22 (32%)
leucine-rich repeat 632..655 CDD:275380 7/22 (32%)
leucine-rich repeat 656..674 CDD:275380 7/17 (41%)
leucine-rich repeat 733..745 CDD:275378 4/11 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.