DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42346 and dma-1

DIOPT Version :9

Sequence 1:NP_001036303.2 Gene:CG42346 / 3355160 FlyBaseID:FBgn0259677 Length:1817 Species:Drosophila melanogaster
Sequence 2:NP_492253.1 Gene:dma-1 / 187968 WormBaseID:WBGene00011345 Length:603 Species:Caenorhabditis elegans


Alignment Length:472 Identity:117/472 - (24%)
Similarity:186/472 - (39%) Gaps:85/472 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   953 CSLGQIPDLLFAKNTNLVRLDL-------CDNRLTQINRNIFSGLNVFKELRLCRNELSDFPHIA 1010
            |....|.|.::|:..|.:.|.|       ..||:..........:|.|.:||:.|......|.::
 Worm    41 CRKAIINDTIYAEILNQLPLTLRSLHIQPPSNRIGSNKLRWNDNINRFAQLRVLRLINCQIPAMS 105

  Fly  1011 -LYNLSTLESLDLARNQLASIDFFKLSGTLNLRQLILRDNKITALSGFNAVNLTQLDSVDLSGNL 1074
             ...|.:||.|||..|.:.........|...||.|.|..|.:..|.......|..|.|:.||.|.
 Worm   106 RSIRLPSLEVLDLHSNNIEHATMSNFGGMPKLRVLDLSSNHLNILPTGVFTYLRALRSLSLSNNT 170

  Fly  1075 LLSLPANFLRHSINLQKVHLSNNRFLQIPSSALSDV--SIPRLSWLNLTGNPINRIYTVKEERYP 1137
            :..|..|.||...:|:.:.|..|   .||...::::  .:.:|..|.|....::.||::..:|.|
 Worm   171 ISDLSTNLLRGLNSLRVLRLDRN---PIPIEHINELFTDVSQLDELYLNHCNLSSIYSLALDRIP 232

  Fly  1138 YLKELYICQTNLSILTSKDFEAFQALQHLHLVNNRITRISPGAFKSLTNLLTLDLSVNEL----- 1197
            .|::|.|...||.::.:|:..:...|..|.|.:|.|..|:..||.: ||:..||||.|.|     
 Worm   233 QLRQLGIGGNNLKMVPTKELRSLPQLSVLDLSHNSIQEITACAFCN-TNISKLDLSHNLLGISKD 296

  Fly  1198 --------EMLPKERLQGLRLLRFLNISHNTLKDL--------------------------EEFS 1228
                    ..:|         ||.|::|.|.:.|.                          |.::
 Worm   297 SPFNEDAFRTMP---------LRHLDLSFNHMNDFDSKWLGWAQEELTSIALSGNFLKNFEESWT 352

  Fly  1229 VDLLEMQTLDLSFNQLDRISKKTFRNLHGLLELFLMGNRMTVLSNDAFRFLRKLHVLDLRKNYFE 1293
            ..|..:..|:|::|.:..|..:.....:.|:.|.:.||.:|.|.::....|..:...|:..|.|.
 Worm   353 YTLKSLIHLELAYNHIKFIPVQLPSRYYHLISLNISGNELTYLPDNINTLLPNVKTFDITANRFH 417

  Fly  1294 LVPLEPLRPLETNLRTLRLEENPLHCSCDAQKLWEWLRDHRKWSLSMGSGAGRGIGGLTGGLGGD 1358
            ......|..| .|:..:.::.||..|||..|.|...:||..         |.|.|          
 Worm   418 TFSHTDLAFL-NNVEQVYVDGNPWDCSCAIQGLQVHMRDRY---------AMRHI---------- 462

  Fly  1359 SINY--LRCEHPTELRG 1373
             :||  :||..|:.:.|
 Worm   463 -LNYDNVRCATPSLVEG 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42346NP_001036303.2 leucine-rich repeat 303..325 CDD:275380
LRR_8 325..384 CDD:290566
leucine-rich repeat 327..350 CDD:275380
leucine-rich repeat 351..461 CDD:275380
LRR_8 373..433 CDD:290566
LRR_RI 397..648 CDD:238064
leucine-rich repeat 399..422 CDD:275380
leucine-rich repeat 462..485 CDD:275380
LRR_8 465..520 CDD:290566
leucine-rich repeat 486..509 CDD:275380
LRR_8 508..567 CDD:290566
leucine-rich repeat 510..533 CDD:275380
LRR_RI 527..785 CDD:238064
leucine-rich repeat 534..556 CDD:275380
LRR_8 555..613 CDD:290566
leucine-rich repeat 557..580 CDD:275380
leucine-rich repeat 581..604 CDD:275380
LRR_8 604..663 CDD:290566
leucine-rich repeat 605..628 CDD:275380
leucine-rich repeat 629..652 CDD:275380
LRR_8 652..711 CDD:290566
leucine-rich repeat 653..676 CDD:275380
leucine-rich repeat 677..700 CDD:275380
leucine-rich repeat 701..748 CDD:275380
leucine-rich repeat 725..736 CDD:275378
leucine-rich repeat 749..772 CDD:275380
LRR_8 771..831 CDD:290566
leucine-rich repeat 773..793 CDD:275380
LRR_RI 804..1076 CDD:238064 35/130 (27%)
LRR_8 821..903 CDD:290566
leucine-rich repeat 821..844 CDD:275380
leucine-rich repeat 845..868 CDD:275380
leucine-rich repeat 869..892 CDD:275380
leucine-rich repeat 893..915 CDD:275380
leucine-rich repeat 916..944 CDD:275380
leucine-rich repeat 945..968 CDD:275380 4/14 (29%)
LRR_8 967..1027 CDD:290566 18/67 (27%)
leucine-rich repeat 969..992 CDD:275380 4/29 (14%)
leucine-rich repeat 993..1014 CDD:275380 5/21 (24%)
LRR_8 1015..1075 CDD:290566 19/59 (32%)
leucine-rich repeat 1017..1040 CDD:275380 7/22 (32%)
leucine-rich repeat 1041..1064 CDD:275380 7/22 (32%)
LRR_RI <1047..1244 CDD:238064 58/237 (24%)
LRR_8 1063..1125 CDD:290566 17/63 (27%)
leucine-rich repeat 1089..1114 CDD:275380 5/26 (19%)
leucine-rich repeat 1115..1162 CDD:275380 13/46 (28%)
LRR_8 1163..1219 CDD:290566 21/68 (31%)
leucine-rich repeat 1163..1186 CDD:275380 8/22 (36%)
leucine-rich repeat 1187..1210 CDD:275380 7/35 (20%)
leucine-rich repeat 1211..1233 CDD:275380 8/47 (17%)
leucine-rich repeat 1234..1257 CDD:275380 4/22 (18%)
LRR_8 1235..1292 CDD:290566 13/56 (23%)
leucine-rich repeat 1258..1279 CDD:275380 6/20 (30%)
leucine-rich repeat 1282..1306 CDD:275380 5/23 (22%)
dma-1NP_492253.1 LRR_8 90..147 CDD:338972 17/56 (30%)
leucine-rich repeat 91..112 CDD:275380 5/20 (25%)
leucine-rich repeat 113..136 CDD:275380 7/22 (32%)
LRR 136..430 CDD:227223 75/307 (24%)
leucine-rich repeat 137..160 CDD:275380 7/22 (32%)
leucine-rich repeat 161..184 CDD:275380 9/22 (41%)
leucine-rich repeat 185..209 CDD:275380 5/26 (19%)
leucine-rich repeat 210..233 CDD:275380 6/22 (27%)
leucine-rich repeat 234..257 CDD:275380 6/22 (27%)
leucine-rich repeat 258..280 CDD:275380 8/22 (36%)
leucine-rich repeat 281..307 CDD:275380 6/25 (24%)
leucine-rich repeat 309..357 CDD:275380 8/47 (17%)
leucine-rich repeat 382..405 CDD:275380 7/22 (32%)
leucine-rich repeat 406..429 CDD:275380 5/23 (22%)
TPKR_C2 438..>478 CDD:387596 17/59 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.