DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42346 and lrrc8a

DIOPT Version :9

Sequence 1:NP_001036303.2 Gene:CG42346 / 3355160 FlyBaseID:FBgn0259677 Length:1817 Species:Drosophila melanogaster
Sequence 2:XP_002935552.1 Gene:lrrc8a / 100492279 XenbaseID:XB-GENE-1012024 Length:809 Species:Xenopus tropicalis


Alignment Length:471 Identity:113/471 - (23%)
Similarity:203/471 - (43%) Gaps:100/471 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 IHSLSIYD------FDRSVTSLSQDVFQPGVHIRHLQFSHS-HLEALKDNSLRNVRSSLE-SLSI 332
            :|.:..||      |...::.:|::      .:|.|..:|. .|:.|:....:|.:..|| .|.:
 Frog   375 LHLIDQYDPLYSKRFAVFLSEVSEN------KLRQLNLNHEWTLDKLRQRITKNSQEKLELHLFM 433

  Fly   333 VNG--------------KLTQMPSRAL-SSMQKLTALD--FDYNEIVRVDDYSFYGLR--ISKLN 378
            ::|              ||..:|...: .|:.:||.|.  :.|:...:::..:...||  :..|:
 Frog   434 LSGIPDTVFDLVELEVLKLELIPDVTIPPSIAQLTGLKELWLYHTAAKIEAPALAFLRENLKSLH 498

  Fly   379 MKGNRLQGMP--EHAFAGLEECMQEIDVSENGLRTFPLMALRKLDHLRILRLSNN--RIPTFYGD 439
            :|...::.:|  .::...|||.....::|....|...:..||:|..|::|||.:|  ::|....|
 Frog   499 IKFTDIKEIPLWIYSLKNLEELHLTGNLSAENNRYIVIDGLRELKRLKVLRLKSNLTKLPQVVTD 563

  Fly   440 I-----QLATNNASAAAAAVGAFQLPSLIFLDLSSNQFAEIGPDCFRAFPQLKTLSFYANQIELV 499
            :     :|:.||.......:.:  |..::.|                            .::|||
 Frog   564 VGVHLQKLSVNNEGTKLMVLNS--LKKMVNL----------------------------TELELV 598

  Fly   500 Q------PEAFKSLRELMSLDMSHNRIIGLDPKV-FEKNKRLQTVDLSHNHIHTIGGVFSNLPQL 557
            :      |.:..||..|..:|:..|.:..::..: |:...||..:.|.:|||..|.....||..|
 Frog   599 RCDLERIPHSIFSLHNLQEIDLKDNNLKTIEEIISFQHLHRLTCLKLWYNHIAYIPIQIGNLASL 663

  Fly   558 REVFLSENNILELPADAF--TNSTNVDVIYLESNAIAHIDPNVFSTLVNLDHLYLRSNFIPLLPV 620
            ..::|:.|.|.::|...|  ....::|   |..|:::.|.|.: ..|.:|.:|.:.:|.|..||.
 Frog   664 ERLYLNRNKIEKIPTQLFLCRKLRHLD---LSHNSLSSIPPEI-GHLQSLQYLAVTANHIENLPA 724

  Fly   621 TLFDKSTKLTSLSLDNNEIQDL--EIGMFRKLEHLREVRLHNNRIRRVRRGVFEPLP-SLQELHI 682
            .|| ...||.:|:|.||.:|.|  .:|   :|.:|.:|.|..||:        |.|| .|.:.|:
 Frog   725 ELF-LCKKLRTLNLGNNVLQSLPSRVG---ELTNLSQVELRGNRL--------EYLPVELGDCHL 777

  Fly   683 QKNSIEDIEPQAFHTL 698
            .|.|...:|...|:||
 Frog   778 LKRSGLVVEEDLFNTL 793

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42346NP_001036303.2 leucine-rich repeat 303..325 CDD:275380 6/22 (27%)
LRR_8 325..384 CDD:290566 16/78 (21%)
leucine-rich repeat 327..350 CDD:275380 8/38 (21%)
leucine-rich repeat 351..461 CDD:275380 28/122 (23%)
LRR_8 373..433 CDD:290566 17/65 (26%)
LRR_RI 397..648 CDD:238064 66/268 (25%)
leucine-rich repeat 399..422 CDD:275380 5/22 (23%)
leucine-rich repeat 462..485 CDD:275380 1/22 (5%)
LRR_8 465..520 CDD:290566 10/60 (17%)
leucine-rich repeat 486..509 CDD:275380 6/28 (21%)
LRR_8 508..567 CDD:290566 16/59 (27%)
leucine-rich repeat 510..533 CDD:275380 4/23 (17%)
LRR_RI 527..785 CDD:238064 56/178 (31%)
leucine-rich repeat 534..556 CDD:275380 8/21 (38%)
LRR_8 555..613 CDD:290566 14/59 (24%)
leucine-rich repeat 557..580 CDD:275380 6/24 (25%)
leucine-rich repeat 581..604 CDD:275380 6/22 (27%)
LRR_8 604..663 CDD:290566 22/60 (37%)
leucine-rich repeat 605..628 CDD:275380 8/22 (36%)
leucine-rich repeat 629..652 CDD:275380 9/24 (38%)
LRR_8 652..711 CDD:290566 16/48 (33%)
leucine-rich repeat 653..676 CDD:275380 8/23 (35%)
leucine-rich repeat 677..700 CDD:275380 8/22 (36%)
leucine-rich repeat 701..748 CDD:275380
leucine-rich repeat 725..736 CDD:275378
leucine-rich repeat 749..772 CDD:275380
LRR_8 771..831 CDD:290566
leucine-rich repeat 773..793 CDD:275380
LRR_RI 804..1076 CDD:238064
LRR_8 821..903 CDD:290566
leucine-rich repeat 821..844 CDD:275380
leucine-rich repeat 845..868 CDD:275380
leucine-rich repeat 869..892 CDD:275380
leucine-rich repeat 893..915 CDD:275380
leucine-rich repeat 916..944 CDD:275380
leucine-rich repeat 945..968 CDD:275380
LRR_8 967..1027 CDD:290566
leucine-rich repeat 969..992 CDD:275380
leucine-rich repeat 993..1014 CDD:275380
LRR_8 1015..1075 CDD:290566
leucine-rich repeat 1017..1040 CDD:275380
leucine-rich repeat 1041..1064 CDD:275380
LRR_RI <1047..1244 CDD:238064
LRR_8 1063..1125 CDD:290566
leucine-rich repeat 1089..1114 CDD:275380
leucine-rich repeat 1115..1162 CDD:275380
LRR_8 1163..1219 CDD:290566
leucine-rich repeat 1163..1186 CDD:275380
leucine-rich repeat 1187..1210 CDD:275380
leucine-rich repeat 1211..1233 CDD:275380
leucine-rich repeat 1234..1257 CDD:275380
LRR_8 1235..1292 CDD:290566
leucine-rich repeat 1258..1279 CDD:275380
leucine-rich repeat 1282..1306 CDD:275380
lrrc8aXP_002935552.1 Pannexin_like 1..339 CDD:372171
leucine-rich repeat 425..446 CDD:275380 4/20 (20%)
PLN00113 <434..>773 CDD:215061 91/384 (24%)
leucine-rich repeat 447..469 CDD:275380 5/21 (24%)
leucine-rich repeat 470..493 CDD:275380 4/22 (18%)
leucine-rich repeat 494..516 CDD:275380 3/21 (14%)
leucine-rich repeat 517..544 CDD:275380 8/26 (31%)
leucine-rich repeat 592..614 CDD:275380 7/49 (14%)
leucine-rich repeat 615..639 CDD:275380 4/23 (17%)
leucine-rich repeat 640..662 CDD:275380 8/21 (38%)
leucine-rich repeat 663..685 CDD:275380 6/21 (29%)
leucine-rich repeat 686..708 CDD:275380 6/25 (24%)
leucine-rich repeat 709..731 CDD:275380 8/22 (36%)
leucine-rich repeat 732..754 CDD:275380 9/24 (38%)
leucine-rich repeat 755..775 CDD:275380 9/27 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.