DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coa7 and AT1G73570

DIOPT Version :9

Sequence 1:NP_001036323.1 Gene:Coa7 / 3355158 FlyBaseID:FBgn0039965 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001319376.1 Gene:AT1G73570 / 843691 AraportID:AT1G73570 Length:629 Species:Arabidopsis thaliana


Alignment Length:244 Identity:51/244 - (20%)
Similarity:82/244 - (33%) Gaps:99/244 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAYDLKKESDVKEYVEKLGVEYRFGCYSEKKPEACHLLGDYLEGIKKDFEKASKVYKSTCDDYGY 65
            :.|..:|.:.|.  :.|:|:.|.||                |.|:::|..||.         |.:
plant   234 LEYQAEKGNSVA--MHKIGLFYYFG----------------LRGLRRDHAKAL---------YWF 271

  Fly    66 AKSCYKYGNYSFLGKGKSGSKGNPQVAYEYYEKGCNLNDSDACLHSGLLLVSKSMPREIDWNVPK 130
            :|:.:....|.:: ||....|.|...|.||:|...|..|.....:.|:|.:..:       .|.|
plant   272 SKAEFNGLGYLYV-KGYGVDKRNYTKAREYFEMAANNEDPSGHYNLGVLYLKGT-------GVKK 328

  Fly   131 GLEFLTKSCDLNNATACFYLSGMHISGVQKKADQSAVTASSGSGTSSPPAGQPPLKDSDYIVLKD 195
                     |:.:||..|:::.                          .||||            
plant   329 ---------DVRHATKYFFVAA--------------------------NAGQP------------ 346

  Fly   196 MKKAFQFAHKACELRNMYACANLSQMYARGDGIEKNEKEAEKYKKLALE 244
              |||.               .|::|:..|.|:.||.:.|..:.||..|
plant   347 --KAFY---------------QLAKMFHTGVGLTKNLEMATTFYKLVAE 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coa7NP_001036323.1 TPR <28..248 CDD:223861 43/217 (20%)
SLR repeat 48..78 CDD:276807 6/29 (21%)
SLR repeat 88..117 CDD:276807 9/28 (32%)
SLR repeat 127..156 CDD:276807 6/28 (21%)
SLR repeat 195..224 CDD:276807 5/28 (18%)
SEL1 214..247 CDD:214772 10/31 (32%)
AT1G73570NP_001319376.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0790
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.