DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coa7 and SEL1L2

DIOPT Version :10

Sequence 1:NP_001036323.1 Gene:Coa7 / 3355158 FlyBaseID:FBgn0039965 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_006723709.1 Gene:SEL1L2 / 80343 HGNCID:15897 Length:689 Species:Homo sapiens


Alignment Length:213 Identity:50/213 - (23%)
Similarity:83/213 - (38%) Gaps:57/213 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 HLLGDYLEGIKKDFEKASKVYKSTCDDYGYAKSCYKYGN---YSFLGK----GKSGSKGNPQVAY 93
            ||:|  .:|:.:|:.||          ..|.....|.|:   .:|:||    |.:....|...|:
Human   307 HLIG--RKGLDQDYYKA----------LHYFLKAAKAGSANAMAFIGKMYLEGNAAVPQNNATAF 359

  Fly    94 EYYEKGCNLNDSDACLHSGLLLV-SKSMPREIDWNVPKGLEFLTKSCDLNNATACFYLSGMHISG 157
            :|:....:..::......|||.. .|.:|    .|..:.|::..|:.:.....|.|.|..|:.  
Human   360 KYFSMAASKGNAIGLHGLGLLYFHGKGVP----LNYAEALKYFQKAAEKGWPDAQFQLGFMYY-- 418

  Fly   158 VQKKADQSAVTASSGSGTSSPPAGQPPLKDSDYIVLKDMKKAFQFAHKACELRNMYACANLSQMY 222
                         ||||                 :.||.|.||::.:.|.:.....|...|::||
Human   419 -------------SGSG-----------------IWKDYKLAFKYFYLASQSGQPLAIYYLAKMY 453

  Fly   223 ARGDGIEKNEKEA-EKYK 239
            |.|.|:.::.:.| |.||
Human   454 ATGTGVVRSCRTAVELYK 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coa7NP_001036323.1 TPR <32..244 CDD:440553 50/213 (23%)
SLR repeat 48..78 CDD:276807 6/32 (19%)
SLR repeat 88..117 CDD:276807 6/29 (21%)
SLR repeat 127..156 CDD:276807 7/28 (25%)
SLR repeat 195..224 CDD:276807 9/28 (32%)
SEL1L2XP_006723709.1 Mplasa_alph_rch <18..>128 CDD:275316
SLR repeat 87..119 CDD:276807
TPR <124..331 CDD:440553 8/35 (23%)
SLR repeat 126..155 CDD:276807
SLR repeat 162..191 CDD:276807
SLR repeat 198..227 CDD:276807
TPR 282..476 CDD:440553 50/213 (23%)
SLR repeat 285..309 CDD:276807 1/1 (100%)
SLR repeat 317..346 CDD:276807 9/38 (24%)
SLR repeat 354..383 CDD:276807 6/28 (21%)
SLR repeat 390..419 CDD:276807 7/43 (16%)
SLR repeat 494..523 CDD:276807
TPR 498..>625 CDD:440553
SLR repeat 534..563 CDD:276807
SLR repeat 570..600 CDD:276807
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.