DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coa7 and LRP2BP

DIOPT Version :10

Sequence 1:NP_001036323.1 Gene:Coa7 / 3355158 FlyBaseID:FBgn0039965 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_060879.2 Gene:LRP2BP / 55805 HGNCID:25434 Length:347 Species:Homo sapiens


Alignment Length:258 Identity:53/258 - (20%)
Similarity:83/258 - (32%) Gaps:100/258 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAYDLKKESDVKE--YVEKLGVEYRFGCYSEKKPEACHLLG-DYLEGI------KKDFEKASKVY 56
            :||.|:.:...:|  |.|.|   .:|....||..:|.:.|| .|.:|:      :|..:...|:.
Human    60 LAYFLRGQLYFEEGWYEEAL---EQFEEIKEKDHQATYQLGVMYYDGLGTTLDAEKGVDYMKKIL 121

  Fly    57 KSTCDDYGYAK--SCYKYGNYSFLGKGKSGS-------------KGNPQVAYE-------YYEKG 99
            .|.|....:.|  :.|..|...:.|||...|             .|||:.:.:       ||   
Human   122 DSPCPKARHLKFAAAYNLGRAYYEGKGVKRSNEEAERLWLIAADNGNPKASVKAQSMLGLYY--- 183

  Fly   100 CNLNDSDACLHSGLLLVSKSMPREIDWNVPKGLEFLTKSCDLNN-----ATACFYLSGMHISGVQ 159
                             |...|:|::    |...:.:::|...|     |....||.|..|.   
Human   184 -----------------STKEPKELE----KAFYWHSEACGNGNLESQGALGLMYLYGQGIR--- 224

  Fly   160 KKADQSAVTASSGSGTSSPPAGQPPLKDSDYIVLKDMKKAFQFAHKACELRNMYACANLSQMY 222
                                              :|.:.|.|...:|.|..|:||..||.:.|
Human   225 ----------------------------------QDTEAALQCLREAAERGNVYAQGNLVEYY 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coa7NP_001036323.1 TPR <32..244 CDD:440553 43/225 (19%)
SLR repeat 48..78 CDD:276807 6/31 (19%)
SLR repeat 88..117 CDD:276807 4/35 (11%)
SLR repeat 127..156 CDD:276807 7/33 (21%)
SLR repeat 195..224 CDD:276807 11/28 (39%)
LRP2BPNP_060879.2 TPR 40..255 CDD:440553 53/258 (21%)
SLR repeat 43..71 CDD:276807 3/10 (30%)
TPR 59..92 10/34 (29%)
SLR repeat 74..102 CDD:276807 10/30 (33%)
Sel1-like 1 93..125 7/31 (23%)
SLR repeat 109..145 CDD:276807 7/35 (20%)
Sel1-like 2 133..168 6/34 (18%)
SLR repeat 152..185 CDD:276807 6/52 (12%)
Sel1-like 3 173..206 7/56 (13%)
SLR repeat 190..219 CDD:276807 6/32 (19%)
Sel1-like 4 207..242 10/71 (14%)
Sel1-like 5 243..277 5/11 (45%)
Sel1-like 6 297..332
SEL1 297..331 CDD:214772
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.