DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coa7 and chr3

DIOPT Version :9

Sequence 1:NP_001036323.1 Gene:Coa7 / 3355158 FlyBaseID:FBgn0039965 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_592847.1 Gene:chr3 / 2541607 PomBaseID:SPAC24B11.10c Length:932 Species:Schizosaccharomyces pombe


Alignment Length:276 Identity:56/276 - (20%)
Similarity:95/276 - (34%) Gaps:98/276 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YDLKKESDVKEYVEKLGVEYRFGCYSEKK---------PEACHLLGDYLEGIKKDFEKASKVYKS 58
            |....|.||.|.:.::.:.|..|...:|:         ..||...|.  |.::..:|.| |:|:.
pombe   702 YKKAAEMDVVEAMFRIALIYLNGLLGQKRNISLGVQWLERACKSKGP--ESVRAMYELA-KIYEQ 763

  Fly    59 TCDDYGYAKSCYKYGNYSFLGKGKSGSKGNPQVAYEYYEKG---------CNLNDSDACLHSGLL 114
            . |.||.:                    ..|:..:|.|::.         |.|.:   |...|||
pombe   764 P-DRYGVS--------------------ATPERKFELYKQSAVYGYAAAQCKLGE---CYEHGLL 804

  Fly   115 LVSKSMPREIDWNVPKGLEFLTKSCDLNNATACFYLSGMHISGVQKKADQSAVTASSGSGTSSPP 179
            .......|.|.|        .|::.:.:...|...|||.:::|                      
pombe   805 GCLAEPRRSIFW--------YTRAAEQDYGEAELGLSGWYLTG---------------------- 839

  Fly   180 AGQPPLKDSDYIVLKDMKKAFQFAHKACELRNMYACANLSQ-------MYARGDGIEKNEKEAEK 237
                    |:.|:.|:.::|..:||||       ||..|::       |..:|.|:..:...|..
pombe   840 --------SEGILPKNGEEALLWAHKA-------ACKGLAKAQYAVGFMMEQGIGVAADPSSAHN 889

  Fly   238 -YKKLALEMQDEVKKQ 252
             |.:.|.:...:.||:
pombe   890 WYIRAAKQGFPKAKKR 905

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coa7NP_001036323.1 TPR <28..248 CDD:223861 47/245 (19%)
SLR repeat 48..78 CDD:276807 7/29 (24%)
SLR repeat 88..117 CDD:276807 9/37 (24%)
SLR repeat 127..156 CDD:276807 5/28 (18%)
SLR repeat 195..224 CDD:276807 9/35 (26%)
SEL1 214..247 CDD:214772 9/40 (23%)
chr3NP_592847.1 TPR 617..925 CDD:223861 56/276 (20%)
SLR repeat 619..650 CDD:276807
SEL1 638..674 CDD:214772
SLR repeat 658..687 CDD:276807
Sel1 675..709 CDD:285450 2/6 (33%)
SLR repeat 694..723 CDD:276807 6/20 (30%)
Sel1 711..744 CDD:285450 5/32 (16%)
SLR repeat 731..763 CDD:276807 8/34 (24%)
SLR repeat 774..801 CDD:276807 5/29 (17%)
Sel1 789..825 CDD:285450 10/46 (22%)
SLR repeat 809..838 CDD:276807 8/36 (22%)
SLR repeat 847..876 CDD:276807 9/35 (26%)
SEL1 864..898 CDD:214772 6/33 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0790
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.