DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coa7 and chr1

DIOPT Version :9

Sequence 1:NP_001036323.1 Gene:Coa7 / 3355158 FlyBaseID:FBgn0039965 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_596099.1 Gene:chr1 / 2540265 PomBaseID:SPBC3E7.12c Length:456 Species:Schizosaccharomyces pombe


Alignment Length:191 Identity:42/191 - (21%)
Similarity:82/191 - (42%) Gaps:12/191 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAYDLKKESDVKEYVEKLGVEYRFGCYSEKKPEACHLLGDYLE--GIKKDFEKASKVYKSTCDDY 63
            :|...||:.:::..:|.|  ||.....:.::....:.|.:..:  |..:|.:....:|.... ..
pombe   264 LAIKAKKDGNLENAIEFL--EYIMPEVASQQNFVPYELAELYKQRGTSQDLKSILPLYMLAA-SL 325

  Fly    64 GYAKSCYKYGNYSFLGKGKSGSKGNPQVAYEYYEKGCNLNDSDACLHSGLLLVSKSMPREIDWNV 128
            |:.:|.:..|...|.  |..|::.|...|.:||....:..::||.| :...|..:.:|..|..:.
pombe   326 GHDRSSFLVGEAFFY--GTYGARENKLRALQYYHLANDKGNADAML-ALCKLYLRGLPGHIFPSS 387

  Fly   129 PKGLEFLTKSCDLNNATACFYLSGMHISGVQKKADQSAVTASSGSGTSSPPAGQPPLKDSD 189
            .:..|:..::..|.:|.||:.|...:.:||....|    .|.|.:|..:......|:.|:|
pombe   388 RRAFEYAHRAAMLGHAPACYVLGKFYETGVGCVKD----LAKSEAGFRAGLINDSPITDAD 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coa7NP_001036323.1 TPR <28..248 CDD:223861 35/164 (21%)
SLR repeat 48..78 CDD:276807 5/29 (17%)
SLR repeat 88..117 CDD:276807 8/28 (29%)
SLR repeat 127..156 CDD:276807 6/28 (21%)
SLR repeat 195..224 CDD:276807
SEL1 214..247 CDD:214772
chr1NP_596099.1 TPR 262..>426 CDD:223861 37/171 (22%)
SLR repeat 273..305 CDD:276807 5/33 (15%)
SLR repeat 311..340 CDD:276807 5/29 (17%)
SLR repeat 347..377 CDD:276807 8/30 (27%)
Sel1 365..402 CDD:285450 8/37 (22%)
SLR repeat 386..415 CDD:276807 6/28 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0790
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.