DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-AGGG and Ndufb2

DIOPT Version :10

Sequence 1:NP_001015476.1 Gene:ND-AGGG / 3355155 FlyBaseID:FBgn0058002 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_080888.1 Gene:Ndufb2 / 68198 MGIID:1915448 Length:105 Species:Mus musculus


Alignment Length:55 Identity:19/55 - (34%)
Similarity:33/55 - (60%) Gaps:0/55 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PPHSKATKIGALTVGGAMWWWVIWHLWHEPDHITGEFDYPNSRKWSNTELGVPKD 92
            |..:::..|....:...||:|::|..||:.|.:.|.|.||:..:|::.|||:|.|
Mouse    48 PQLTRSQVIQGEFLSSLMWFWILWRFWHDSDAVLGHFSYPDPSQWTDEELGIPPD 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-AGGGNP_001015476.1 NADH_B2 26..94 CDD:464329 19/55 (35%)
Ndufb2NP_080888.1 NADH_B2 37..104 CDD:464329 19/55 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..105 8/17 (47%)

Return to query results.
Submit another query.