DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-AGGG and NDUFB2

DIOPT Version :10

Sequence 1:NP_001015476.1 Gene:ND-AGGG / 3355155 FlyBaseID:FBgn0058002 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_004537.1 Gene:NDUFB2 / 4708 HGNCID:7697 Length:105 Species:Homo sapiens


Alignment Length:40 Identity:17/40 - (42%)
Similarity:28/40 - (70%) Gaps:0/40 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GAMWWWVIWHLWHEPDHITGEFDYPNSRKWSNTELGVPKD 92
            |.||:|::|..||:.:.:.|.|.||:..:|::.|||:|.|
Human    63 GLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPD 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-AGGGNP_001015476.1 NADH_B2 26..94 CDD:464329 17/40 (43%)
NDUFB2NP_004537.1 NADH_B2 37..104 CDD:464329 17/40 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..105 8/18 (44%)

Return to query results.
Submit another query.