DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and ATHB13

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_177136.1 Gene:ATHB13 / 843314 AraportID:AT1G69780 Length:294 Species:Arabidopsis thaliana


Alignment Length:249 Identity:51/249 - (20%)
Similarity:88/249 - (35%) Gaps:42/249 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 GTMSHMGNMSGLAAC-------SVSDSKPLQFPLAQRRKRRVLFTQAQVYELERRFKQQRYLSAP 281
            |..|.:|..|.:..|       :::..:......:|..:::......||..||:.|:....|...
plant    46 GFASFLGKRSPMEGCCDLETGNNMNGEEDYSDDGSQMGEKKRRLNMEQVKTLEKNFELGNKLEPE 110

  Fly   282 EREHLASLIHLTPTQVKIWFQNHRYKCKRQAKEK----------AMAEQNQ----HNQPASSPRR 332
            .:..||..:.|.|.|:.|||||.|.:.|.:..||          .:..:|.    |||      :
plant   111 RKMQLARALGLQPRQIAIWFQNRRARWKTKQLEKDYDTLKRQFDTLKAENDLLQTHNQ------K 169

  Fly   333 VAVPVLVKDGKPCSGNNSSSQSQQHGTNSTSAGNNTGSANNGNANSGIVSVTANVSGGLNLITGD 397
            :...::        |..:..|::....|..:.|:.:..::|.:.|..:...||..|....|..|.
plant   170 LQAEIM--------GLKNREQTESINLNKETEGSCSNRSDNSSDNLRLDISTAPPSNDSTLTGGH 226

  Fly   398 APNSHSPDTSSSLLASYGTVGGSNVAMLQQPCNNTLMSNSLAMAYRNQNNFISN 451
            .|   .|.|.............:......|...|:....|:.    .:.|.|||
plant   227 PP---PPQTVGRHFFPPSPATATTTTTTMQFFQNSSSGQSMV----KEENSISN 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 17/52 (33%)
ATHB13NP_177136.1 Homeobox 85..138 CDD:395001 17/52 (33%)
HALZ 140..182 CDD:396657 7/55 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.