DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and HB52

DIOPT Version :10

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_200209.1 Gene:HB52 / 835481 AraportID:AT5G53980 Length:156 Species:Arabidopsis thaliana


Alignment Length:147 Identity:31/147 - (21%)
Similarity:53/147 - (36%) Gaps:41/147 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 DDALKLFDEMVKKKVKP-----TGVTFGTLIHGLCKDSRVKEALKMKHDMLKVYGVRPTVHIYAS 228
            ||   :.|..|.::.:|     .||....:......::.:...|: |:...|.|        |.|
plant   123 DD---IMDNSVTRRGQPCWYRKEGVGLDAVNDSFLLEASIYRILR-KYCRGKPY--------YLS 175

  Fly   229 LIKALCQIG---ELSFAFKL-------------KDEAYEGKIKVDAAIYS---TLISSLIKAGRS 274
            |::...:..   ||..|..|             .::.|:..:|...|.||   .:.:::..||.:
plant   176 LLELFLETSYQTELGQALDLITAQPGKVDLNRYTEKRYKAIVKYKTAFYSFYLPVAAAMYMAGIA 240

  Fly   275 NEVS-----MILEEMSE 286
            .|..     .||.||.|
plant   241 GEAEHTNARTILLEMGE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeodomain 254..310 CDD:459649 12/41 (29%)
HB52NP_200209.1 Homeodomain 11..64 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.