DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and HB-7

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_182191.1 Gene:HB-7 / 819280 AraportID:AT2G46680 Length:258 Species:Arabidopsis thaliana


Alignment Length:117 Identity:32/117 - (27%)
Similarity:50/117 - (42%) Gaps:23/117 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 QRRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNH--RYKCKRQAKE 314
            |||     |:..|:..||..|:.:..|...::..||..:.|.|.||.|||||.  |:|.|:...|
plant    33 QRR-----FSDEQIKSLEMMFESETRLEPRKKVQLARELGLQPRQVAIWFQNKRARWKSKQLETE 92

  Fly   315 KAMAEQNQHN-----QPASSPRRVAVPVLVK-----------DGKPCSGNNS 350
            ..:..||..|     :.....::..|..|.:           :.:.|||:.:
plant    93 YNILRQNYDNLASQFESLKKEKQALVSELQRLKEATQKKTQEEERQCSGDQA 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 19/54 (35%)
HB-7NP_182191.1 Homeobox 35..85 CDD:395001 19/54 (35%)
HALZ 87..126 CDD:396657 7/38 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.