DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and Nkx6-3

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001102925.1 Gene:Nkx6-3 / 685102 RGDID:1597780 Length:262 Species:Rattus norvegicus


Alignment Length:255 Identity:66/255 - (25%)
Similarity:103/255 - (40%) Gaps:84/255 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 TPFSVTDILS-PIEESYRKLELNGNPPSPFRSNSSSSSINSPGTLTTSTMANPYAMGTLYHSPGV 177
            ||..:||||| |:......| |:|.|     ..:....::|.|               :|:.|.|
  Rat    51 TPHGITDILSRPVATPNSSL-LSGYP-----HVAGFGGLSSQG---------------VYYGPQV 94

  Fly   178 QTYCGPTDNLSLAGHYTDMRN-----SASWYGSTANDPRFAISRLMSSSASGTMSHMGNMSGLAA 237
            .:: ..|.|    .:.|..||     ...|.|||                             ..
  Rat    95 GSF-SKTGN----EYPTRTRNCWADTGQDWRGST-----------------------------RP 125

  Fly   238 CSVSDSKPLQFPLAQRRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQ 302
            || :...||...:.:::..|..||..|::.||:.|:|.:||:.|||..||..:.:|.:|||:|||
  Rat   126 CS-NTPDPLSDTIHKKKHTRPTFTGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQ 189

  Fly   303 NHRYKCKRQAKEKAMAEQNQHNQPASSPRRVAVPVLVKDGKP--CSGNNSSSQSQQHGTN 360
            |.|.|.:   |:.|:       :|:||..|.          |  .||:.::|:::....|
  Rat   190 NRRTKWR---KKSAL-------EPSSSTPRA----------PGGASGDRAASENEDDEYN 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 25/52 (48%)
Nkx6-3NP_001102925.1 Homeobox 143..197 CDD:395001 25/56 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336884
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.