DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and NKX2-4

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_149416.1 Gene:NKX2-4 / 644524 HGNCID:7837 Length:354 Species:Homo sapiens


Alignment Length:295 Identity:141/295 - (47%)
Similarity:171/295 - (57%) Gaps:49/295 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 HSTPFSVTDILSPIEESYRKLE--LNGNPP---------SPFRS---NSSSSSINSPGTLTTSTM 162
            |:|||||:||||||||:|:|..  ::|.||         :.:|:   ..||.:....|...:..|
Human     7 HTTPFSVSDILSPIEETYKKFSGAMDGAPPGLGAPLGAAAAYRAPPPGPSSQAATVAGMQPSHAM 71

  Fly   163 AN------------PYAMGTLYH-SPGVQ--------TYC-GPTDNLSLAGHYTD-MRNSAS--W 202
            |.            ..|....|| .|||.        :|| |...|:.....||| ||..|:  |
Human    72 AGHNAAAAAAAAAAAAAAAATYHMPPGVSQFPHGAMGSYCNGGLGNMGELPAYTDGMRGGAATGW 136

  Fly   203 YGSTANDPRF-AISRLMSSSASGTMSHMGNMSGL--AACSVSDSKPLQFPLAQRRKRRVLFTQAQ 264
            ||:.. |||: :|||.|..||...::.||:::|:  ||.|:..........|.||||||||:|||
Human   137 YGANP-DPRYSSISRFMGPSAGVNVAGMGSLTGIADAAKSLGPLHAAAAAAAPRRKRRVLFSQAQ 200

  Fly   265 VYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKCKRQAKEKAMAEQNQHN----- 324
            |||||||||||:||||||||||||:||||||||||||||||||.|||||:||..:..|..     
Human   201 VYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQLQQEGGLGPP 265

  Fly   325 -QPASSPRRVAVPVLVKDGKPCSGNNSSSQSQQHG 358
             .|..|||||||||||||||||....|:....|.|
Human   266 PPPPPSPRRVAVPVLVKDGKPCQNGASTPTPGQAG 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 49/52 (94%)
NKX2-4NP_149416.1 Homeobox 192..245 CDD:278475 49/52 (94%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..329 28/55 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143167
Domainoid 1 1.000 114 1.000 Domainoid score I6085
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41526
Inparanoid 1 1.050 221 1.000 Inparanoid score I3557
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1348801at2759
OrthoFinder 1 1.000 - - FOG0002967
OrthoInspector 1 1.000 - - otm41843
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24340
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2571
SonicParanoid 1 1.000 - - X524
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.890

Return to query results.
Submit another query.