DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and nkx2.4b

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_571664.1 Gene:nkx2.4b / 58112 ZFINID:ZDB-GENE-000830-1 Length:307 Species:Danio rerio


Alignment Length:329 Identity:151/329 - (45%)
Similarity:186/329 - (56%) Gaps:56/329 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 HSTPFSVTDILSPIEESYRKLELNGNPPSPFRSNSSSSSINSP---------GTLTTSTMANPYA 167
            |||||||:||||||||:::|          |.:..||:|:.||         ..|...:|::   
Zfish     7 HSTPFSVSDILSPIEETFKK----------FAAMESSASLASPLYRQSQVSQANLQQHSMSH--- 58

  Fly   168 MGTLYHSPGVQ-------TYCGPTDNL--SLAGHYTDMRNSA---SWYGSTANDPRF-AISRLMS 219
              ..||.|..|       .||..|...  .|..:...|||.|   :||||.. :||: .|||.|.
Zfish    59 --NAYHMPHSQFSHSTMGGYCNGTIGAMGDLPSYQESMRNGATATAWYGSNP-EPRYPTISRFMG 120

  Fly   220 SSASGTMSHMGNMSGLAACSVSDSKPL-QFPLAQRRKRRVLFTQAQVYELERRFKQQRYLSAPER 283
            .||.   .:||.:.|:.|     ||.: ....|.||||||||:||||||||||||||:|||||||
Zfish   121 PSAG---MNMGTLPGMDA-----SKSMVTLHAAPRRKRRVLFSQAQVYELERRFKQQKYLSAPER 177

  Fly   284 EHLASLIHLTPTQVKIWFQNHRYKCKRQAKEKAMAEQNQHNQPA-SSPRRVAVPVLVKDGKPCSG 347
            |||||:||||||||||||||||||.|||||:||..:|:..|..| .||||||:||||||||||. 
Zfish   178 EHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKASQQQDSGNMCAQQSPRRVALPVLVKDGKPCQ- 241

  Fly   348 NNSSSQSQQHGTNSTSAGNNT-GSANNGNANSGIVSVTANVSGGLNLITGDAPNSHSPDTSSSLL 411
            |.|.:.:..|....:..|:.| .||.:...    :|.:..:.|||:..........|...||:||
Zfish   242 NGSGTPTPIHQQVQSVLGSETLASAEDLEE----MSPSPPLMGGLSQTDAALIEYTSSMVSSNLL 302

  Fly   412 ASYG 415
              ||
Zfish   303 --YG 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 49/52 (94%)
nkx2.4bNP_571664.1 Homeobox 150..203 CDD:278475 49/52 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576026
Domainoid 1 1.000 114 1.000 Domainoid score I6020
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 224 1.000 Inparanoid score I3491
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1348801at2759
OrthoFinder 1 1.000 - - FOG0002967
OrthoInspector 1 1.000 - - otm24364
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24340
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2571
SonicParanoid 1 1.000 - - X524
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1010.030

Return to query results.
Submit another query.