DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and NKX3-2

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001180.1 Gene:NKX3-2 / 579 HGNCID:951 Length:333 Species:Homo sapiens


Alignment Length:309 Identity:95/309 - (30%)
Similarity:123/309 - (39%) Gaps:103/309 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 SNHSTPFSVTDILSPIEESYRKLELNGNPPSPFRSNSSSSSINSPGTLTTSTMANPY-------- 166
            :|..|.||:..||:..||........|.|              :||....|..|.|.        
Human     6 ANTLTSFSIQAILNKKEERGGLAAPEGRP--------------APGGTAASVAAAPAVCCWRLFG 56

  Fly   167 -----AMG----TLYHSP-GVQTYCGPT------------------------------------D 185
                 |:|    :|..|| |.:|..|.|                                    .
Human    57 ERDAGALGGAEDSLLASPAGTRTAAGRTAESPEGWDSDSALSEENESRRRCADARGASGAGLAGG 121

  Fly   186 NLSL----------------AGHYTDMRNSASWYGS----TAND---PRFAISRLMSSSASGTMS 227
            :|||                |...:|...|||..|.    |.:|   ||.|....:.|.|.|   
Human   122 SLSLGQPVCELAASKDLEEEAAGRSDSEMSASVSGDRSPRTEDDGVGPRGAHVSALCSGAGG--- 183

  Fly   228 HMGNMSGLAACSVSDSKPLQFPLAQRRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHL 292
              |..||.|..:..:.:|.. |..::::.|..|:.|||:||||||..|||||.|||..||:.:.|
Human   184 --GGGSGPAGVAEEEEEPAA-PKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKL 245

  Fly   293 TPTQVKIWFQNHRYKCKRQAKEKAMAEQNQHNQPASSPRRVAVPVLVKD 341
            |.|||||||||.|||.||    :.||.....:.||:  ::|||.|||:|
Human   246 TETQVKIWFQNRRYKTKR----RQMAADLLASAPAA--KKVAVKVLVRD 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 35/52 (67%)
NKX3-2NP_001180.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..113 7/47 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 138..212 21/79 (27%)
Homeobox 209..262 CDD:278475 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143174
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.