DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and nkx3-1

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001373254.1 Gene:nkx3-1 / 555375 ZFINID:ZDB-GENE-081104-238 Length:185 Species:Danio rerio


Alignment Length:79 Identity:42/79 - (53%)
Similarity:53/79 - (67%) Gaps:5/79 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 CSVSDSKPLQFPL-----AQRRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQV 297
            |..|:.|.:....     .::::.|..||..||.|||::|.:|||||||||.||||.:|||.|||
Zfish    49 CRTSEGKTVSSTEMTGGGGKKKRSRAAFTHLQVLELEKKFSRQRYLSAPERTHLASALHLTETQV 113

  Fly   298 KIWFQNHRYKCKRQ 311
            ||||||.|||.||:
Zfish   114 KIWFQNRRYKTKRR 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 37/52 (71%)
nkx3-1NP_001373254.1 COG5576 15..>136 CDD:227863 42/79 (53%)
Homeobox 72..126 CDD:395001 37/53 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576045
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.