DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and NKX1-1

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001277008.1 Gene:NKX1-1 / 54729 HGNCID:24975 Length:448 Species:Homo sapiens


Alignment Length:415 Identity:95/415 - (22%)
Similarity:125/415 - (30%) Gaps:174/415 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 TPFSVTDILSPIEESYRKLE-------------------------LNGNPP-------------- 139
            |.|||.|||.|.:.:.|:..                         .:|.||              
Human    80 TSFSVLDILDPNKFNSRRRRCVLLGPVAPAACAPCASAPCAPAPAASGRPPRAEELERRALAGAG 144

  Fly   140 -------------SPFRSNSSSSSINSPGTLTTSTMANPYAMGTLYHSP---------------- 175
                         .||::..:.         |..|  |.|:.|...|||                
Human   145 GVGAAGAEPPNAGDPFKAGEAE---------TNDT--NGYSSGGGGHSPSADSGDEVPDDEDDDE 198

  Fly   176 ----------GVQTYCGPTDNLSLAGH------YTDMRNSASWYGSTANDPRFAISRLMSSSASG 224
                      |.:...|....|...|.      .||....|:...:.|..|| ..|.:......|
Human   199 DEAPETEAARGAEEARGGGGGLGARGSGCQGAAETDASPGATVDEAAAPGPR-ENSPVAQGPPGG 262

  Fly   225 TMSHMG---NMSGLAACSV-------SDSKPLQFPLAQRRKRRVLFTQAQVYELERRFKQQRYLS 279
            ..:..|   ...|.|..:.       ||||.     .:.|:.|..||..|:..||.:||..||||
Human   263 AAAPGGAGTTPQGTATAAKPKRKRTGSDSKS-----GKPRRARTAFTYEQLVALENKFKATRYLS 322

  Fly   280 APEREHLASLIHLTPTQVKIWFQNHRYKCKRQAKEKAMAEQNQHNQPASSPRRVAVPVLVKDGKP 344
            ..||.:||..:.||.|||||||||.|.|.|:|                 :|              
Human   323 VCERLNLALSLSLTETQVKIWFQNRRTKWKKQ-----------------NP-------------- 356

  Fly   345 CSGNNSSSQSQQHGTNSTSAGNNTGSANNGNANSGIVSVTANVSGGLNLITGDAPNSHSPDTSSS 409
              |.::|:.:...|.....||..||                 :.|||      :|.|.||...:.
Human   357 --GADTSAPTGGGGGPGPGAGPGTG-----------------LPGGL------SPLSPSPPMGAP 396

  Fly   410 LLASYGTVG------GSNVAMLQQP 428
             |..:|..|      |..|...|.|
Human   397 -LGMHGPAGYPAHGPGGLVCAAQLP 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 29/52 (56%)
NKX1-1NP_001277008.1 Homeobox 300..352 CDD:278475 29/51 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143186
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.