DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and HGTX

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster


Alignment Length:378 Identity:95/378 - (25%)
Similarity:143/378 - (37%) Gaps:101/378 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 NETSTQNTVSTAAAAAVAHHHHNLS--SIHHLQNLHSQHQSTLFNSNHSTPFSVTDILSP----- 124
            |:.|.:|..|..|.   ..|||.::  ::|:..  |:.:.....|:||.........|.|     
  Fly   241 NDYSPENLSSQRAK---FQHHHGVNPLALHNAN--HAGNPGCHNNNNHMDHKLPLSFLGPPLAAL 300

  Fly   125 --------------IEESYRKLELNGNPPSPFRSN-SSSSSINSPGTLTTSTMA----NPYAMGT 170
                          ...|...|..:.:|.|...|: .|..|.:|..|.||:|.:    ||:.:.|
  Fly   301 HSMTTEMKGQGVGGSSASANGLSYSHSPNSHLISDRGSGGSSSSSSTTTTNTNSQGAPNPHGIDT 365

  Fly   171 LYHSP--------------------------GVQTYCGPTDNLSL---AGHYTDMRNSASW---Y 203
            :...|                          |:..|...:....|   |||..| |....|   .
  Fly   366 ILSKPPPVTSAGLSALTGAGIPRFSIAAAAAGMAQYLSQSQGAPLKTHAGHIVD-RTHLYWPGLQ 429

  Fly   204 GSTANDP---RFAISRLMSSSASGTMSHMGNMSGLAACSVSDSKPLQFPLAQRRKRRVLFTQAQV 265
            |..|| |   |..:|..||::.|  .||..:.|     :..|.|        ::..|..|:..|:
  Fly   430 GLVAN-PIAWRERLSNTMSANLS--QSHQHHPS-----NDKDGK--------KKHTRPTFSGQQI 478

  Fly   266 YELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKC-KRQAKEKAMAEQNQHNQPASS 329
            :.||:.|:|.:||:.|||..||..:.::.:|||:||||.|.|. ||.|.|.|.|::.|.:....:
  Fly   479 FALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRHAAEMATAKRKQDDMGGDN 543

  Fly   330 PRRVAVPVLVKDGKPC-----SGNNSSSQSQQHGTNSTSAGNNTGSANNGNAN 377
                       || .|     |.|.|....:....|.....|::||:.....|
  Fly   544 -----------DG-DCSETMDSDNESLDMGESPAQNKRCRSNSSGSSQQQQDN 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 23/53 (43%)
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 31/151 (21%)
Homeobox 469..523 CDD:395001 23/53 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442251
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24340
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.