DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and nkx2.2b

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001007783.2 Gene:nkx2.2b / 493627 ZFINID:ZDB-GENE-050217-3 Length:237 Species:Danio rerio


Alignment Length:151 Identity:72/151 - (47%)
Similarity:93/151 - (61%) Gaps:17/151 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 DMRNSASWYGSTANDPRFAISRLMSSSASGTMSHMGNMSGLAACSVSDSKPLQFPLAQRRKRRVL 259
            |....|.|.||:... ::.:.   |:|.......:.....:...|..||       .::||||:|
Zfish    48 DSSRDALWLGSSCGH-KYPVP---SASPEELNPELSADESVDRESSEDS-------GKKRKRRIL 101

  Fly   260 FTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKCKRQAKEKAMAEQNQHN 324
            |::.|.:||||||:||||||||||||||.|:|||||||||||||||||.||...||.:      :
Zfish   102 FSKTQTFELERRFRQQRYLSAPEREHLAKLLHLTPTQVKIWFQNHRYKVKRARAEKGL------D 160

  Fly   325 QPASSPRRVAVPVLVKDGKPC 345
            ....|||||::||||:||:||
Zfish   161 PYLLSPRRVSIPVLVRDGRPC 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 43/52 (83%)
nkx2.2bNP_001007783.2 Homeobox 98..151 CDD:278475 43/52 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576040
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X524
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.