DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and NKX6-1

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_006159.2 Gene:NKX6-1 / 4825 HGNCID:7839 Length:367 Species:Homo sapiens


Alignment Length:267 Identity:65/267 - (24%)
Similarity:106/267 - (39%) Gaps:75/267 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 LNGNPPSPFRSNSSSSS------INSPGTLTTS---------------TMANPYAMGTLYHSPGV 177
            |...|||...|:|||||      .::||.|...               :.|.|:.:..:...|.:
Human    43 LPAGPPSSSSSSSSSSSPSPPLGTHNPGGLKPPATGGLSSLGSPPQQLSAATPHGINDILSRPSM 107

  Fly   178 QTYCGPT-DNLSLAGHYTDMRNSASWYGSTANDPRFAISRLMSSSASGTMSHMGNMSGL------ 235
            ....|.. .:.|.:|..:...:|||...::|.....|.:...:||.:|.::.:...|.|      
Human   108 PVASGAALPSASPSGSSSSSSSSASASSASAAAAAAAAAAAAASSPAGLLAGLPRFSSLSPPPPP 172

  Fly   236 -------AACSVSDSKPLQFPLAQ---------------------------------------RR 254
                   :|.:|:.......|||:                                       |:
Human   173 PGLYFSPSAAAVAAVGRYPKPLAELPGRTPIFWPGVMQSPPWRDARLACTPHQGSILLDKDGKRK 237

  Fly   255 KRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKC-KRQAKEKAMA 318
            ..|..|:..|::.||:.|:|.:||:.|||..||..:.:|.:|||:||||.|.|. |:.|.|.|.|
Human   238 HTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEMATA 302

  Fly   319 EQNQHNQ 325
            ::.|.::
Human   303 KKKQDSE 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 24/53 (45%)
NKX6-1NP_006159.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..133 21/89 (24%)
Repressor domain. /evidence=ECO:0000250 102..268 32/165 (19%)
Homeobox 239..293 CDD:395001 24/53 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 294..367 5/16 (31%)
Involved in DNA-binding. /evidence=ECO:0000250 306..367 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143180
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.