Sequence 1: | NP_001015473.1 | Gene: | scro / 3355151 | FlyBaseID: | FBgn0287186 | Length: | 468 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_006159.2 | Gene: | NKX6-1 / 4825 | HGNCID: | 7839 | Length: | 367 | Species: | Homo sapiens |
Alignment Length: | 267 | Identity: | 65/267 - (24%) |
---|---|---|---|
Similarity: | 106/267 - (39%) | Gaps: | 75/267 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 134 LNGNPPSPFRSNSSSSS------INSPGTLTTS---------------TMANPYAMGTLYHSPGV 177
Fly 178 QTYCGPT-DNLSLAGHYTDMRNSASWYGSTANDPRFAISRLMSSSASGTMSHMGNMSGL------ 235
Fly 236 -------AACSVSDSKPLQFPLAQ---------------------------------------RR 254
Fly 255 KRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKC-KRQAKEKAMA 318
Fly 319 EQNQHNQ 325 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
scro | NP_001015473.1 | Homeobox | 256..309 | CDD:278475 | 24/53 (45%) |
NKX6-1 | NP_006159.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 36..133 | 21/89 (24%) | |
Repressor domain. /evidence=ECO:0000250 | 102..268 | 32/165 (19%) | |||
Homeobox | 239..293 | CDD:395001 | 24/53 (45%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 294..367 | 5/16 (31%) | |||
Involved in DNA-binding. /evidence=ECO:0000250 | 306..367 | 1/4 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165143180 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |