DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and NKX2-2

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_002500.1 Gene:NKX2-2 / 4821 HGNCID:7835 Length:273 Species:Homo sapiens


Alignment Length:286 Identity:106/286 - (37%)
Similarity:130/286 - (45%) Gaps:83/286 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 SNHSTPFSVTDIL--------------SPIEESYRKLELNGNPPSPFRSNSSSSSINSPGTLTTS 160
            :|..|.|||.|||              .|.||:        ..|.|                  :
Human     4 TNTKTGFSVKDILDLPDTNDEEGSVAEGPEEEN--------EGPEP------------------A 42

  Fly   161 TMANPYAMGTLYHSPGVQTYCGPTDNLSLAGHYTDMRNS--ASWYGSTANDPRFAISRLMSSSAS 223
            ..|.|...|.|   ..||       :|.|...:.|..::  ..|..|| ...::::..|   :|.
Human    43 KRAGPLGQGAL---DAVQ-------SLPLKNPFYDSSDNPYTRWLAST-EGLQYSLHGL---AAG 93

  Fly   224 GTMSHMGNMSGLAACSVSDSKPLQFP-----LAQRRKRRVLFTQAQVYELERRFKQQRYLSAPER 283
            .......:.|...:...|.....:.|     ..::|||||||::||.|||||||:||||||||||
Human    94 APPQDSSSKSPEPSADESPDNDKETPGGGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPER 158

  Fly   284 EHLASLIHLTPTQVKIWFQNHRYKCKRQAKEKAMAEQNQHNQPASSPRRVAVPVLVKDGKPCSGN 348
            |||||||.||||||||||||||||.||     |.||:.....|..|||||||||||:|||||...
Human   159 EHLASLIRLTPTQVKIWFQNHRYKMKR-----ARAEKGMEVTPLPSPRRVAVPVLVRDGKPCHAL 218

  Fly   349 NS-----------------SSQSQQH 357
            .:                 |:||.||
Human   219 KAQDLAAATFQAGIPFSAYSAQSLQH 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 47/52 (90%)
NKX2-2NP_002500.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56 17/80 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..131 6/43 (14%)
Homeobox 131..185 CDD:395001 47/53 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143179
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X524
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.