DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and nkx6.1

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001002475.1 Gene:nkx6.1 / 436748 ZFINID:ZDB-GENE-040718-178 Length:312 Species:Danio rerio


Alignment Length:334 Identity:77/334 - (23%)
Similarity:123/334 - (36%) Gaps:113/334 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 SQHQSTLFNSNHSTP-----FSVTDILSPIEESYRKLELNGNPPSPFRSNSSSS------SINSP 154
            |:..:.|.|    ||     .|:|::.:|:..:|   .|:...|:...|.:::|      .::||
Zfish    10 SRQSAFLLN----TPPLAALHSMTEMKTPLYPAY---PLSSTGPASSTSPTATSPNPGGIPVSSP 67

  Fly   155 GTLTTS-----------TMANPYAMGTLYHSPGVQTYCGPTDNLSLAGHYTDM------------ 196
            |..|:|           .:|.|:.:..:...|.|.  |.|...||....::.:            
Zfish    68 GIKTSSGLSALASAQQCAIATPHGINDILSRPSVA--CSPAGILSGLPRFSSLSPPPPPGLYFSP 130

  Fly   197 -------------------RNSASWYGSTANDPRFAISRLMSSSASGTMSHMGNMSGLAACSVSD 242
                               |....|.| ....|.:..:|.                   |||...
Zfish   131 SAAAVAVARYPKPLTELPGRTPIFWPG-VMQSPHWRDARF-------------------ACSPHQ 175

  Fly   243 SKPLQFPLAQRRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYK 307
            :..|.....:|:..|..|:..|::.||:.|:|.:||:.|||..||..:.:|.:|||:||||.|.|
Zfish   176 NSVLLDKDGKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTK 240

  Fly   308 C-KRQAKEKAMAEQNQHNQ----------------------PASSPRRVAVPVLVKDGKPCS--- 346
            . ||.|.|.|.|::.|.::                      |.|...::.  .|:|..||.|   
Zfish   241 WRKRHAAEMASAKKKQDSETERLKGASENEDDDDDYNKPLDPNSDDEKIT--QLLKKHKPNSALI 303

  Fly   347 ---GNNSSS 352
               ..|.||
Zfish   304 IHTSENESS 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 24/53 (45%)
nkx6.1NP_001002475.1 Homeobox 189..242 CDD:278475 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576041
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.