DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and bap

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster


Alignment Length:385 Identity:108/385 - (28%)
Similarity:153/385 - (39%) Gaps:107/385 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 STPFSVTDILSPIEESYRKLELNGNPPSPFRSNSSS----SSINSP----GTLTTSTMANPYAMG 169
            :||||:.|||:......|::....:.|.|.:...||    |...||    ..|....:..|..:.
  Fly    21 TTPFSINDILTRSNPETRRMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDLGLYKLTQPKEIQ 85

  Fly   170 TLYHSPG--VQTYCGPTDN-----------LSLAGHYTDMRNSASWYGSTANDP---RFAISR-- 216
            .....|.  :|.|....||           .|.|..|  |:...:::|||...|   |...|.  
  Fly    86 PSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADY--MQRKLAYFGSTLAAPLDMRRCTSNDS 148

  Fly   217 -------LMSSSASGTMSHMGNMSGLAACSVSDSKPLQFPLAQRRKR-RVLFTQAQVYELERRFK 273
                   |.||.:...:||.|  |||:                |:|| |..|:.|||:||||||.
  Fly   149 DCDSPPPLSSSPSESPLSHDG--SGLS----------------RKKRSRAAFSHAQVFELERRFA 195

  Fly   274 QQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKCKRQAKEKAMAEQNQHNQPA--SSPRRVAVP 336
            ||||||.|||..:|..:.||.|||||||||.|||.||        :|.|.::.|  .:.:||.|.
  Fly   196 QQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKR--------KQIQQHEAALLGASKRVPVQ 252

  Fly   337 VLVKDGKPCSGNNSSSQSQQHGTNSTSAGNNTGSANNGNANSGIVSVTAN----VSGGLNLITGD 397
            |||::....:..:.::....||                 .:..::::..:    ..|||.|....
  Fly   253 VLVREDGSTTYAHMAAPGAGHG-----------------LDPALINIYRHQLQLAYGGLPLPQMQ 300

  Fly   398 APNSH-----------SPDTSSSLLASYGTVGGSNVAM--------LQQPC---NNTLMS 435
            .|..:           .|.|.||...:..:...|.|.:        .:.||   |..:||
  Fly   301 MPFPYFYPQHKVPQPIPPPTQSSSFVTASSASSSPVPIPIPGAVRPQRTPCPSPNGQMMS 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 36/53 (68%)
bapNP_732637.1 Homeobox 178..231 CDD:278475 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442243
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0842
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I4000
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24340
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.