DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and tin

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster


Alignment Length:433 Identity:106/433 - (24%)
Similarity:163/433 - (37%) Gaps:149/433 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 QHHQ--------------------VDTSTKLNTNETSTQNTV-------------------STAA 79
            ||||                    :..:..|||...|.::.:                   :||:
  Fly     3 QHHQQQAQSGGYYDHYTQSPSPGSLTNADALNTTPFSVKDILNMVNQTEAYEGSYGHIDGAATAS 67

  Fly    80 AAAVA-----------HHHHNLSSIH-HLQNLHSQHQSTLFNSNHSTPFSVTDILSP----IEES 128
            |...|           |..|..|.:. ..|.||.||    .:...:|..|::.:|.|    :...
  Fly    68 ALFAAGEYQNPHQYLNHQQHQQSELPIPQQQLHHQH----LDDGATTSSSLSPLLPPPPHQLYGG 128

  Fly   129 YRKLEL--------NGNP--------------PSPFRSNSSSSSINSPGTLTTSTM--------A 163
            |:...:        :|:|              .|.|.:.:|:::..:|.|...:..        |
  Fly   129 YQDYGMPAHMFQHHHGHPHQSFQHSASAYNMSASQFYAGASATAYQTPATYNYNYAGSGEVYGGA 193

  Fly   164 NPYAMG-------TLYHSPG----------VQTYCGPTDNLSL----------AGHYTDMRNSAS 201
            .|.|:|       |.|.:|.          |.:...||..|.:          |.:.:.:|   |
  Fly   194 TPSAVGIKSEYIPTPYVTPSPTLDLNSSAEVDSLQAPTQKLCVNPLSQRLMETASNSSSLR---S 255

  Fly   202 WYGSTANDPRFAISRLMSS-------SASGTMSHMGNMSGLAACSVSDSKPLQFPLAQRRKRRVL 259
            .|||.....:...|::.||       |.||. |:.|:.||       .:||     ..:||.|||
  Fly   256 IYGSDEGAKKKDNSQVTSSRSELRKNSISGN-SNPGSNSG-------STKP-----RMKRKPRVL 307

  Fly   260 FTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKCKR----------QAKE 314
            |:||||.|||.||:.::||:..|||.:|..::|:.|||||||||.|||.||          ..|.
  Fly   308 FSQAQVLELECRFRLKKYLTGAEREIIAQKLNLSATQVKIWFQNRRYKSKRGDIDCEGIAKHLKL 372

  Fly   315 KAMAEQNQHNQPASSPRRVAVPVLVKDGKPCSGNNSSSQSQQH 357
            |:....:..:.|...|..|..|..::..:....:::..|..||
  Fly   373 KSEPLDSPTSLPPPIPNHVMWPPTMQQSQQQQQHHAQQQQMQH 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 32/52 (62%)
tinNP_524433.1 HOX 301..357 CDD:197696 34/55 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0842
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24340
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.