DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and ems

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster


Alignment Length:367 Identity:74/367 - (20%)
Similarity:116/367 - (31%) Gaps:136/367 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 HHHHNLSSIHHLQNLHSQHQSTLFNSNH-STPFSVTDI----------------LSPI------- 125
            |.|.:||....    |..||..|....| .||.|..||                |||:       
  Fly   107 HPHPHLSPAQQ----HVLHQHLLMQQQHPGTPKSHQDIQELLQRLHHNAAMASGLSPLQTRLSPE 167

  Fly   126 ------------------------EESYRKLELNGNPPSPFRSNSSSSSINSPGTLTTSTMANP- 165
                                    |...::::....||......||..| :||..|.:|..|.| 
  Fly   168 TEQPQMAVSLKRERSPAPPAMEQAENPAQRIQPPHTPPKSVSPQSSQPS-SSPTLLISSPHATPP 231

  Fly   166 ----------YAMGTLYHSPGVQTYCGP--TDNLSLAG-------------------HYTDMRNS 199
                      |....:.|..|    .||  ...:..||                   ...|::..
  Fly   232 QQQQQQPPPNYPKPAMMHPGG----AGPMMMPGMPPAGLVRPFPMGPGGPPMPQGQPGLPDIKAL 292

  Fly   200 ASWYGS-----TANDPRFAISRLMSSSASGTMSH-MGNMSGLAACSVSDSKPLQF---------- 248
            ..:..:     ..::|....:.....:|:....| :|..:..||.:.......||          
  Fly   293 PPYINAPPELPPQHNPHLIAAAQFQMAAALQAGHVLGPAAAAAAAAGLPPHAAQFMPNPGMARDS 357

  Fly   249 --------------------------PLAQRRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLA 287
                                      |..:.::.|..|:.:|:.:||..|:..:|:...||:.||
  Fly   358 YQLYPWLLSRHGRIFPHRFPGSFLVPPFRKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALA 422

  Fly   288 SLIHLTPTQVKIWFQNHRYKCKRQAKE-----KAMAEQNQHN 324
            ..::|:.||||:||||.|.|.||..:|     :..:::|.||
  Fly   423 QNLNLSETQVKVWFQNRRTKHKRMQQEDEKGGEGGSQRNMHN 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 22/52 (42%)
emsNP_731868.1 Homeobox 392..444 CDD:278475 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24340
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.