DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and nkx1.2la

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_997995.2 Gene:nkx1.2la / 405755 ZFINID:ZDB-GENE-040615-1 Length:270 Species:Danio rerio


Alignment Length:337 Identity:83/337 - (24%)
Similarity:116/337 - (34%) Gaps:113/337 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 SNHSTPFSVTDILSPIEESYRKLELNGNPPSPFRSNSSSSSINSPGTLTTSTMANPYAMGTLYHS 174
            |:|...||:.|||.|.:.:.:|.:::.      :..:|||.....|:|..|....        ||
Zfish    13 SDHRISFSIIDILDPTKFTSKKTDVSE------KERTSSSENTGFGSLEESRNGK--------HS 63

  Fly   175 PGVQTYCGPTDNLSLAGHYTDMRNSASWYGSTANDPRFAISRLMSSSASGTMSHMGNMSGLAACS 239
            .|   .|..|      |..:|.|:..........|..|..|          .||....||.:.|.
Zfish    64 DG---ECEST------GDRSDDRHGCVRLHPPDPDVDFDCS----------SSHRSLKSGFSPCE 109

  Fly   240 VSDS------KPLQFPLAQRRKR------------RVLFTQAQVYELERRFKQQRYLSAPEREHL 286
            ..|.      .|....::::|:|            |..||..|:..||.:|:..||||..||.:|
Zfish   110 DPDEAAEERMTPAPDDVSRQRRRRSDHSCAKPRRARTAFTYEQLVALENKFRATRYLSVCERLNL 174

  Fly   287 ASLIHLTPTQVKIWFQNHRYKCKRQAKEKAMAEQNQHNQPASSPRRVAVPVLVKDGKPCSGNNSS 351
            |..:.||.|||||||||.|.|.|:|                                    |...
Zfish   175 ALSLSLTETQVKIWFQNRRTKWKKQ------------------------------------NPGV 203

  Fly   352 SQSQQHGTNSTSAGNNTGSANNGNANSGIVSVTANVSGGLNLITGDAPNSHSPDTSSSLLASYGT 416
            ..|.|.||||                      ..|:|..    .|.|...|.|.::.:::...|.
Zfish   204 ESSLQAGTNS----------------------LPNISPS----CGSASALHPPFSTGNMIFHSGP 242

  Fly   417 VGGSNVAMLQQP 428
            |..::.|.|..|
Zfish   243 VHLASSAGLLHP 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 29/64 (45%)
nkx1.2laNP_997995.2 Homeobox 145..197 CDD:278475 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576037
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.