DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and Nkx2-4

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_038962557.1 Gene:Nkx2-4 / 366213 RGDID:1304985 Length:353 Species:Rattus norvegicus


Alignment Length:347 Identity:150/347 - (43%)
Similarity:192/347 - (55%) Gaps:65/347 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 HSTPFSVTDILSPIEESYRKL--ELNGNPP---SPFRSNSSSSSINSPGTLTTST--MANPYAM- 168
            |:|||||:||||||||:|:|.  .::|.||   :|..:.:..:....|.:...:.  |..|:|| 
  Rat     7 HTTPFSVSDILSPIEETYKKFGGVMDGAPPGLGAPLGAAAYRAPPTGPSSQAAAVAGMQPPHAMA 71

  Fly   169 -----------------GTLYH-SPGVQ--------TYC-GPTDNLSLAGHYTD-MRNSAS---- 201
                             ...|| .|||.        :|| |...|:.....||| ||..|:    
  Rat    72 GHNAAAAAAAAAAAAAAAATYHMPPGVSQFPHSAMGSYCNGGLGNMGELPAYTDGMRGGAAAAAT 136

  Fly   202 -WYGSTANDPRF-AISRLMSSSASGTMSHMGNMSGLAACSVSDSKPLQFPLAQRRKRRVLFTQAQ 264
             |||:. .|||: :|||.|..||...::.||:::|:|..:.| ..||. ..|.||||||||:|||
  Rat   137 GWYGAN-TDPRYSSISRFMGPSAGVNVAGMGSLTGIADAAKS-LAPLH-AAAPRRKRRVLFSQAQ 198

  Fly   265 VYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKCKRQAKEKAMAEQNQHN----- 324
            |||||||||||:||||||||||||:||||||||||||||||||.|||||:||..:..|..     
  Rat   199 VYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQLQQEGGLGPP 263

  Fly   325 --QPASSPRRVAVPVLVKDGKPC---SGNNSSSQSQQHGTNSTSAGNNTGSANN-------GNAN 377
              .|..|||||||||||||||||   :|..:..|..|.....|.|......:::       |...
  Rat   264 PPPPPPSPRRVAVPVLVKDGKPCQNGAGTPTPGQGGQQPQAPTPASELEELSSSPPALHGPGGGL 328

  Fly   378 SGIVSVTANVSGGL---NLITG 396
            :.:.:.|.:..||:   ||:.|
  Rat   329 AALDTATGDYGGGVLGANLLYG 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 49/52 (94%)
Nkx2-4XP_038962557.1 Homeobox 190..244 CDD:395001 49/53 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 114 1.000 Domainoid score I5913
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41526
Inparanoid 1 1.050 218 1.000 Inparanoid score I3494
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1348801at2759
OrthoFinder 1 1.000 - - FOG0002967
OrthoInspector 1 1.000 - - otm45980
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24340
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X524
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.070

Return to query results.
Submit another query.