DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and Nkx2-6

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001121125.1 Gene:Nkx2-6 / 364418 RGDID:1306149 Length:213 Species:Rattus norvegicus


Alignment Length:217 Identity:90/217 - (41%)
Similarity:110/217 - (50%) Gaps:42/217 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 ISRLMSSSASGTMSHMGNMSGLAACSVSDSKPLQFPLAQRRKRRVLFTQAQVYELERRFKQQRYL 278
            :..||.....|..|.....:|          |:......|||.||||:||||..|||||||||||
  Rat    21 VENLMMEHGVGNRSDDPRRAG----------PVPTVTRPRRKPRVLFSQAQVLALERRFKQQRYL 75

  Fly   279 SAPEREHLASLIHLTPTQVKIWFQNHRYKCKRQAKEKAMAEQNQHNQPASSPRRVAVPVLVKDGK 343
            ||||||||||::.||.|||||||||.|||||||.:::.: |...|   ..:||||||||||.|.|
  Rat    76 SAPEREHLASVLQLTSTQVKIWFQNRRYKCKRQRQDQTL-ELAGH---PLAPRRVAVPVLVLDVK 136

  Fly   344 PCSGNNS-------------SSQSQQHGT--NSTSAGNNTGSANNGNANSGIVSVTANVS---GG 390
            ||...:.             |..|...||  :::.||..||      |..|.::..|:..   ||
  Rat   137 PCLDPDRHAFPSPYATTVLYSCFSSYTGTPYSASYAGRYTG------AGPGPLAPLASSGFSPGG 195

  Fly   391 LNLITGDAPNSHSPDTSSSLLA 412
            .:.    ||..|...|...:.|
  Rat   196 QSA----APQGHLAATPQGVTA 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 43/52 (83%)
Nkx2-6NP_001121125.1 Homeobox 53..107 CDD:395001 44/53 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336903
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.