DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and pnx

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_840087.1 Gene:pnx / 352939 ZFINID:ZDB-GENE-030328-42 Length:182 Species:Danio rerio


Alignment Length:241 Identity:58/241 - (24%)
Similarity:80/241 - (33%) Gaps:97/241 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 HQSTLFNSNHS----TPFSVTDILSPIEESYRKLELNGNPPSPFRSNSSSSSINSPGTLTTSTMA 163
            |:.|   ||.:    |.||:.|||.|       .:.||...:...||      |.....|||...
Zfish     2 HEET---SNSTLQGKTSFSIADILDP-------AKFNGTRETREISN------NRESPKTTSPTQ 50

  Fly   164 NPYAMGTLYHSPGVQTYCGPTDNLSLAGHYTDMRNSASWYGSTANDPRFAISRLMSSSASGTMSH 228
            .|.|                                                             
Zfish    51 EPSA------------------------------------------------------------- 54

  Fly   229 MGNMSGLAACSVSDSKPLQFPLAQRRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLT 293
             .|::..:|..|           :.::.|..||..|:..|||.|:...|||..||..:||.:.|:
Zfish    55 -PNIANASAAKV-----------KSKRIRTAFTLDQLRILERSFQSSHYLSVFERHCIASALGLS 107

  Fly   294 PTQVKIWFQNHRYKCKRQAKEKAMAEQNQHNQPAS---SPRRVAVP 336
            .|||||||||.|.|.|::..... .|:..|..|.:   :|...|:|
Zfish   108 ETQVKIWFQNRRTKWKKELDGHG-GEEQSHCAPTALTQNPIMYALP 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 27/52 (52%)
pnxNP_840087.1 Important for interaction with tle3a. /evidence=ECO:0000269|PubMed:12642490 1..34 13/41 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..63 12/113 (11%)
Homeobox 71..123 CDD:278475 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576030
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.