DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and HOXA4

DIOPT Version :10

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_002132.3 Gene:HOXA4 / 3201 HGNCID:5105 Length:320 Species:Homo sapiens


Alignment Length:110 Identity:35/110 - (31%)
Similarity:50/110 - (45%) Gaps:12/110 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 RKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKCKRQAKEKAMA 318
            ::.|..:|:.||.|||:.|...|||:...|..:|..:.|:..||||||||.|.|.|:..|.....
Human   216 KRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKWKKDHKLPNTK 280

  Fly   319 EQNQHNQPASSPRRVAVPVLVKDGKPCSGNNSSSQSQQHGTNSTS 363
            .::.::..||:            |.|......|.....|...|||
Human   281 MRSSNSASASA------------GPPGKAQTQSPHLHPHPHPSTS 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeodomain 254..310 CDD:459649 24/55 (44%)
HOXA4NP_002132.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..77
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..168
Antp-type hexapeptide 194..199
Homeodomain 216..272 CDD:459649 24/55 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 273..320 10/53 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.