DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and Nkx6-2

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001101028.1 Gene:Nkx6-2 / 309095 RGDID:1307280 Length:277 Species:Rattus norvegicus


Alignment Length:272 Identity:71/272 - (26%)
Similarity:102/272 - (37%) Gaps:92/272 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 TPFSVTDILS-PIEESYRKLELNGNPPSPFRSNSSSSSINSPGTLTTSTMANPYAMGTLYHSPGV 177
            ||..::|||. |:..:..  .|.|:.|   |.|..:||..                  :|..|..
  Rat    56 TPHGISDILGRPVGAAGG--GLLGSLP---RLNGLASSAG------------------VYFGPAA 97

  Fly   178 QTYCG-PTDNLSLAGHYTDMRNSASW----YGSTANDPRFAISRLMSSSASGTMSHMGNMSGLAA 237
            ....| |.....|.|     |....|    .||...|||.|    .|:.|.|.:...|       
  Rat    98 AVARGYPKPLAELPG-----RPPIFWPGVVQGSPWRDPRLA----GSAQAGGVLDKDG------- 146

  Fly   238 CSVSDSKPLQFPLAQRRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQ 302
                          :::..|..|:..|::.||:.|:|.:||:.|||..||..:.:|.:|||:|||
  Rat   147 --------------KKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQ 197

  Fly   303 NHRYKC-KRQAKEKAMAEQNQ-------------------HNQPA---SSPRRVAVPVLVKDGK- 343
            |.|.|. ||.|.|.|.|::.|                   :|:|.   |...::.  .|:|..| 
  Rat   198 NRRTKWRKRHAAEMASAKKKQDSDAEKLKVGGSDAEDDDEYNRPLDPNSDDEKIT--RLLKKHKP 260

  Fly   344 -------PCSGN 348
                   ||.|:
  Rat   261 SNLALVSPCGGS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 24/53 (45%)
Nkx6-2NP_001101028.1 Homeobox 151..205 CDD:395001 24/53 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336886
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.