DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and nkx2.2a

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001295569.1 Gene:nkx2.2a / 30697 ZFINID:ZDB-GENE-980526-403 Length:273 Species:Danio rerio


Alignment Length:296 Identity:110/296 - (37%)
Similarity:137/296 - (46%) Gaps:87/296 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 LQNLHSQHQSTLFNSNHSTPFSVTDILSPIEESYRKLELNGNPPSPFRSNSSSSSINSPGTLTTS 160
            |||:..        :|..|.|||.|||...:.:..:..:.|..    .....|.:..:||.|..|
Zfish     2 LQNMSL--------TNTKTGFSVKDILDLPDTNDEEGSITGTE----EDTEGSEATKTPGVLVQS 54

  Fly   161 TMANPYAMGTLYHSPGVQTYCGPTDNLSLAGHYTDMRNSASWYGSTANDPRFAISRLMSSSASGT 225
            .:.|                   ..||.|...:.|  ||.:.|           :|.:::    |
Zfish    55 PLEN-------------------VQNLPLKNPFYD--NSDNPY-----------TRWLAT----T 83

  Fly   226 MSHMGNMSGLAACSVSDSKPLQFPLA------------------QRRKRRVLFTQAQVYELERRF 272
            .|...::.||:|.|...|.....|.|                  ::|||||||::||.|||||||
Zfish    84 DSIQYSLHGLSANSQDTSAKSPEPSADESPDNDKETSSNGSDSGKKRKRRVLFSKAQTYELERRF 148

  Fly   273 KQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKCKRQAKEKAMAEQNQHNQPASSPRRVAVPV 337
            :|||||||||||||||||.||||||||||||||||.||...||.|...:     ..|||||||||
Zfish   149 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTH-----LPSPRRVAVPV 208

  Fly   338 LVKDGKPCSGNNS----------------SSQSQQH 357
            ||:|||||....:                |:||.||
Zfish   209 LVRDGKPCHTLKAQDLAATFQAGIPFSAYSAQSLQH 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 47/52 (90%)
nkx2.2aNP_001295569.1 COG5576 93..218 CDD:227863 76/129 (59%)
Homeobox 132..185 CDD:278475 47/52 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576039
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X524
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.