DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and nkx2.5

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_571496.2 Gene:nkx2.5 / 30696 ZFINID:ZDB-GENE-980526-321 Length:314 Species:Danio rerio


Alignment Length:340 Identity:117/340 - (34%)
Similarity:161/340 - (47%) Gaps:63/340 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 LFNSN-HSTPFSVTDILSPIEESYRKLELNGNPPSPFRSNSSSSSINSPGTLTTSTMANPYAM-- 168
            :|:|. .||||||.|||:        ||.|   .....|...|..::|....|:|.|.:.:..  
Zfish     3 MFSSQMTSTPFSVRDILN--------LEQN---QEDMVSLDMSQRLDSALIPTSSCMLSTFKQEQ 56

  Fly   169 ------GTLYHSPGVQTYCG---PTDNLSLAGHYTDMRNSASWYGSTANDPRFAISRLMSSSASG 224
                  |:...|..:|...|   .:.|.|.:|.|........:......|..|...         
Zfish    57 FMEMPSGSSLFSEDLQEDKGNKINSINFSASGFYAKNFLEMDYVKDAKTDDTFEDK--------- 112

  Fly   225 TMSHMGNMSGLAACSVSDSKPLQFPLAQ------RRKRRVLFTQAQVYELERRFKQQRYLSAPER 283
                  ....:..|.....:.|:...|:      |||.||||:||||||||||||||:|||||||
Zfish   113 ------EKKDIGCCQEDPGEDLKLDDAERPKQRKRRKPRVLFSQAQVYELERRFKQQKYLSAPER 171

  Fly   284 EHLASLIHLTPTQVKIWFQNHRYKCKRQAKEKAMAEQNQHNQPASSPRRVAVPVLVKDGKPCSGN 348
            :|||:::.||.|||||||||.|||||||.:::.:....     .:.|||::|||||:|||||.|:
Zfish   172 DHLANVLKLTSTQVKIWFQNRRYKCKRQRQDQTLEMVG-----IAPPRRISVPVLVRDGKPCLGD 231

  Fly   349 NSSSQSQ-----QHGTNST--------SAGNNTGSANNGNANSGIVSVTANVSGGLNLITGDAPN 400
            .|:..:.     .|.|.:|        |.||:..|.|..::.|.|....:| |..:|...||..|
Zfish   232 TSTYNTSYNVGINHFTYNTYPAFSNFPSPGNSNYSCNYPSSMSSIQPSQSN-SNYMNFGVGDLNN 295

  Fly   401 SHSPDTSSSLLASYG 415
            ..:...|||:.:.:|
Zfish   296 VQASFQSSSVPSLHG 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 42/52 (81%)
nkx2.5NP_571496.2 Homeobox 144..197 CDD:306543 42/52 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576043
Domainoid 1 1.000 47 1.000 Domainoid score I11994
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.