DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and Nkx3-1

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001029316.1 Gene:Nkx3-1 / 305999 RGDID:1305369 Length:238 Species:Rattus norvegicus


Alignment Length:251 Identity:71/251 - (28%)
Similarity:101/251 - (40%) Gaps:89/251 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 SNHSTPFSVTDILSPIEESYRKLELNGNP--------PSPFRSNSS------SSSINSPGTLTTS 160
            |...|.|.:.|||.  :.:.|:   .|.|        |.|.|.::|      .||:         
  Rat    27 SKRLTSFLIQDILR--DHAERR---GGQPSTPQHQCQPDPKRDSASELDEAEGSSV--------- 77

  Fly   161 TMANPYAMGTLYHSPGVQTYCGPTDNLSLAGHYTDMRNSASWYGSTANDPRFAISRLMSSSASGT 225
                     ||...||:::  .||:..:                .|.:|..|.            
  Rat    78 ---------TLEDPPGIRS--SPTETRA----------------ETESDAHFE------------ 103

  Fly   226 MSHMGNMSGLAACS---VSDSKPLQFPLAQRRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLA 287
                   :.|..|.   |..|.| |.....:::.|..|:..||.||||:|..|:|||||||.|||
  Rat   104 -------TYLLDCEHTPVLSSAP-QVTKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLA 160

  Fly   288 SLIHLTPTQVKIWFQNHRYKCKRQ--AKEKAMAEQNQHNQPASSPRRVAVPVLVKD 341
            ..:.||.|||||||||.|||.||:  :::..:.|:|.         .:::|.|..|
  Rat   161 KNLKLTETQVKIWFQNRRYKTKRRQLSEDLGVLEKNS---------TLSLPTLKDD 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 34/52 (65%)
Nkx3-1NP_001029316.1 Homeobox 129..182 CDD:278475 34/52 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336905
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.