DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and Nkx1-1

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_234082.6 Gene:Nkx1-1 / 298981 RGDID:1564874 Length:443 Species:Rattus norvegicus


Alignment Length:398 Identity:92/398 - (23%)
Similarity:125/398 - (31%) Gaps:148/398 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 TPFSVTDILSPIEESYRKLE-------------------------LNGNPPSPFRSNSSSSSINS 153
            |.|||.|||.|.:.:.|:..                         .:|..|   |:.....::::
  Rat    83 TSFSVLDILDPNKFNSRRRRCVLLGPVVPATCAPCAPAACVPVPAASGRSP---RAELERRALSA 144

  Fly   154 PGTLTTSTMANPYAMGTLY----------------------------------HSPGVQTYCGPT 184
            ...:..:|.|.|.:.|..|                                  .:|.||...|..
  Rat   145 ATGVAAATGAEPTSTGDSYRADEAEANGYSSGSGRSPTADSEDEAPEEDEDEDQAPEVQDVQGTE 209

  Fly   185 D----NLSLAGHYTDMRNSASWYGSTANDPRFAISRLMSSSASG---TMSHMGNM----SGLAAC 238
            :    :..|....:....:|....|..::......|..|..|.|   |.:..||.    .|.|..
  Rat   210 EPRGGSGGLGARGSGCSGAAEVEASPVDEAAAPGPRGNSPGAPGPPVTAAGAGNAGSTPQGAAVA 274

  Fly   239 SV-------SDSKPLQFPLAQRRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQ 296
            :.       ||||.     .:.|:.|..||..|:..||.:||..||||..||.:||..:.||.||
  Rat   275 TKPKRKRTGSDSKS-----GKPRRARTAFTYEQLVALENKFKATRYLSVCERLNLALSLSLTETQ 334

  Fly   297 VKIWFQNHRYKCKRQAKEKAMAEQNQHNQPASSPRRVAVPVLVKDGKPCSGNNSSSQSQQHGTNS 361
            |||||||.|.|.|:|             .|.:                                .
  Rat   335 VKIWFQNRRTKWKKQ-------------NPGA--------------------------------D 354

  Fly   362 TSAGNNTGSANNGNANSGIVSVTANVSGGLNLITGDAPNSHSPDTSSSLLASYGTVG------GS 420
            |||....|......|..|     |.:.|||      :|.|.||...:. ||.:|..|      |.
  Rat   355 TSAPTGGGGGPGPGAGPG-----AGLPGGL------SPLSPSPPMGAP-LALHGPAGYPAHSPGG 407

  Fly   421 NVAMLQQP 428
            .|...|.|
  Rat   408 LVCAAQLP 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 29/52 (56%)
Nkx1-1XP_234082.6 Homeobox 295..347 CDD:278475 29/51 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336906
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.