DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and Nkx1-2

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001163947.1 Gene:Nkx1-2 / 293568 RGDID:1306744 Length:305 Species:Rattus norvegicus


Alignment Length:343 Identity:84/343 - (24%)
Similarity:117/343 - (34%) Gaps:116/343 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 SNHSTPFSVTDILSPIEESYRKLELNGNPPSPFRSNSSSSSI------------NSPGTLTTSTM 162
            |:|...|||.|||.|  :.:.:..|   ||....:..:..|:            |..|:..|   
  Rat    14 SHHKISFSVLDILDP--QKFTRAAL---PPVRLAALEAKKSLVEVEAGEDACSGNPIGSQET--- 70

  Fly   163 ANPYAMGTLYHSPGVQTYCGPTDNLS-LAGHYTDMRNSAS----------WYGSTANDPRFAISR 216
              |.|:|            |.||..| :.|...:....|.          |.|:.|..       
  Rat    71 --PDAVG------------GGTDPASPVEGSEAEEEEEAEDAGRAQRPERWQGAHAGS------- 114

  Fly   217 LMSSSASGTMSHMGNMSGLAACSVSDSKP------LQFPLAQRRKRRVLFTQAQVYELERRFKQQ 275
             :.:.|....:......||.|...|...|      .:...|:.|:.|..||..|:..||.:|:..
  Rat   115 -LEAGAVAVGTEESGADGLPASPGSPGSPRPRRRRAESSCAKPRRARTAFTYEQLVALENKFRAT 178

  Fly   276 RYLSAPEREHLASLIHLTPTQVKIWFQNHRYKCKRQAKEKAMAEQNQHNQPASSPRRVAVPVLVK 340
            ||||..||.:||..:.||.|||||||||.|.|.|:|             .|.:            
  Rat   179 RYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQ-------------NPGA------------ 218

  Fly   341 DGKPCSGNNSSSQSQQHGTNSTSAGNNTGSANNGNANSGIVSVTANVSGGLNLITGDAPNSHSPD 405
            ||                  :..||.:.......||          |:||....||.:|   .|.
  Rat   219 DG------------------AVQAGGSAPQPGTPNA----------VTGGGGSATGSSP---GPP 252

  Fly   406 TSSSL-LASYGTVGGSNV 422
            ...:| ..::.|...:||
  Rat   253 VPGALPFQTFPTYPATNV 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 28/52 (54%)
Nkx1-2NP_001163947.1 Homeobox 160..213 CDD:395001 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336897
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.