DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and Nkx2-1

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_011242403.1 Gene:Nkx2-1 / 21869 MGIID:108067 Length:423 Species:Mus musculus


Alignment Length:371 Identity:157/371 - (42%)
Similarity:196/371 - (52%) Gaps:60/371 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 IHHLQNLHSQHQSTLFNSNHSTPFSVTDILSPIEESYRKLELNGN----PPSPFRSNSSS----- 148
            :|..::..|:.:....:..|:|||||:|||||:||||:|:.:.|.    |.:.:|...::     
Mouse    39 VHPTRSALSRRRIMSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPAAA 103

  Fly   149 ---SSINSPGTLTTSTMANPYAMGTLYHSPGVQTYC-GPTDNLSLAGHYTD-MRNSAS---WYGS 205
               .::...|.:|.:.......:..|.|| .|..|| |...|:|....|.| ||||||   |||:
Mouse   104 MQQHAVGHHGAVTAAYHMTAAGVPQLSHS-AVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGA 167

  Fly   206 TANDPRF-AISRLMSSSASGTMSHMGNMSGLAACSVSDSKPLQFPLAQRRKRRVLFTQAQVYELE 269
            .. |||| ||||.|..::...||.||.:..|...| .:..||  |.|.||||||||:||||||||
Mouse   168 NP-DPRFPAISRFMGPASGMNMSGMGGLGSLGDVS-KNMAPL--PSAPRRKRRVLFSQAQVYELE 228

  Fly   270 RRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKCKRQAKEKAMAEQ-------------- 320
            ||||||:||||||||||||:||||||||||||||||||.|||||:||..:|              
Mouse   229 RRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGG 293

  Fly   321 ----NQHNQPASSPRRVAVPVLVKDGKPCSGN-------NSSSQSQQHGTNSTSAGNNTGSANNG 374
                .|......|||||||||||||||||...       :..|.:||.......|.....:|   
Mouse   294 AGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQSHAQQQAQQQAQAAQAAAAA--- 355

  Fly   375 NANSGIVSVTANVSGGLNLITGDAPNS--HSPDTSSSLLASYGTVG 418
                  :||.:. ..||....|..|.|  .|||.:....:..|..|
Mouse   356 ------ISVGSG-GAGLGAHPGHQPGSAGQSPDLAHHAASPAGLQG 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 49/52 (94%)
Nkx2-1XP_011242403.1 Homeobox 215..269 CDD:395001 49/53 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833346
Domainoid 1 1.000 114 1.000 Domainoid score I6067
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 220 1.000 Inparanoid score I3550
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002967
OrthoInspector 1 1.000 - - otm43892
orthoMCL 1 0.900 - - OOG6_108513
Panther 1 1.100 - - O PTHR24340
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2571
SonicParanoid 1 1.000 - - X524
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.780

Return to query results.
Submit another query.