DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and ceh-28

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_510169.4 Gene:ceh-28 / 191619 WormBaseID:WBGene00000450 Length:201 Species:Caenorhabditis elegans


Alignment Length:219 Identity:74/219 - (33%)
Similarity:101/219 - (46%) Gaps:57/219 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 QSTLFNSNHSTPFSVTDILSPIEESYRKLELNGNPPSPFRSNSSSSSIN--SPGTLTTSTMANPY 166
            |||..:|  :|....::::.|.::|        ..||.|: |:..|.:|  .....:.|.:.|||
 Worm     2 QSTQISS--TTVILPSEVIQPPQQS--------AVPSEFK-NTLPSRLNLFEGFDQSFSELTNPY 55

  Fly   167 AMGTLYHSPGVQTYCGPTDNLSLAGHYTDMRNSASWYGSTANDPRFAISRLMSSSASGTMSHMGN 231
                       |.........||.|       ::|:|.|.:.:.|         |......|   
 Worm    56 -----------QPVIPLMQRESLLG-------ASSYYSSPSQNQR---------SYQNHRQH--- 90

  Fly   232 MSGLAACSVSDSKPLQFPL---AQRRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLT 293
                       |.|....|   .|:||.||||||.||.|||.|||:|||::|.|||.||..:.||
 Worm    91 -----------SNPDTINLRSQQQKRKPRVLFTQHQVNELEERFKKQRYVTATEREELAQCLGLT 144

  Fly   294 PTQVKIWFQNHRYKCKRQAKEKAM 317
            .|||||||||.||||||.|:::.:
 Worm   145 ATQVKIWFQNRRYKCKRLAQDRTL 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 37/52 (71%)
ceh-28NP_510169.4 HOX 104..160 CDD:197696 39/55 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164177
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.