powered by:
Protein Alignment scro and R03G8.1
DIOPT Version :9
Sequence 1: | NP_001015473.1 |
Gene: | scro / 3355151 |
FlyBaseID: | FBgn0287186 |
Length: | 468 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_510172.2 |
Gene: | R03G8.1 / 187544 |
WormBaseID: | WBGene00010996 |
Length: | 663 |
Species: | Caenorhabditis elegans |
Alignment Length: | 121 |
Identity: | 31/121 - (25%) |
Similarity: | 40/121 - (33%) |
Gaps: | 40/121 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 50 TAISQHHQVDTSTK----LNTNETSTQ---NTVSTAAAAAVAHHHHNLSSIHHLQNLHSQHQSTL 107
||||..:.:.|:|. ||.|....| :|.:|.............|:|..||....:.||.|
Worm 441 TAISVPNSLRTNTDILKILNMNSEKLQTHFDTRATILDILKFQPAEKFSAITPLQIPGEKGQSHL 505
Fly 108 -----FNSNHSTPFSVTDILSPIEESYRKLELNGNPPSPF-----RSNSSSSSINS 153
||.|..| .|.|| :.|.:|..|||
Worm 506 RNQPPFNRNCQT-----------------------MPIPFEYCICQFNKTSVPINS 538
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
scro | NP_001015473.1 |
Homeobox |
256..309 |
CDD:278475 |
|
R03G8.1 | NP_510172.2 |
DUF229 |
74..651 |
CDD:281053 |
31/121 (26%) |
ALP_like |
175..483 |
CDD:293745 |
12/41 (29%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0842 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.