DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and ceh-27

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001256348.1 Gene:ceh-27 / 185853 WormBaseID:WBGene00000449 Length:263 Species:Caenorhabditis elegans


Alignment Length:277 Identity:81/277 - (29%)
Similarity:119/277 - (42%) Gaps:95/277 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 NSNHSTPFSVTDILSPIEESYRKLELNGNPPSPFRSNSSSSSINSPGTLTTSTMANPYAMGTLYH 173
            ||:.|.|.|||    |..:::                 |:.||::|.  ||:...:.:|....| 
 Worm     7 NSSTSAPNSVT----PTTDAF-----------------STLSISAPA--TTAAQMSYFAFPNQY- 47

  Fly   174 SPGVQTYCGPTDNLSLAGHYTDMRNSASWYGST----ANDPRFA-ISRLMSSSASGTMSHMGNMS 233
                     |.|..|.        |:::.|.:.    |..|:.| .:|..::..:..::...|| 
 Worm    48 ---------PHDFSSY--------NTSAAYATAPYPMATHPQLANFNRFQTNQLNLGLTTQQNM- 94

  Fly   234 GLAACSVSDSKPLQFPLAQRRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVK 298
                            :..||||||||:..||:.|||:|:..|||||.:||:||..|:|:.||||
 Worm    95 ----------------MISRRKRRVLFSPQQVHVLERKFQINRYLSAADRENLAKSINLSATQVK 143

  Fly   299 IWFQNHRYKCKRQAKEKAMAEQNQHNQPASSPRRVAVPVLVKDGKPCSGNNSSSQSQQHGTNSTS 363
            |||||.|||||||.|||.|                       ||.....::..:.|.:       
 Worm   144 IWFQNQRYKCKRQEKEKKM-----------------------DGGCYRDSDRDTDSDR------- 178

  Fly   364 AGNNTGSANNGNANSGI 380
              :|..|.:.|::.|||
 Worm   179 --DNDSSGSLGSSMSGI 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 34/52 (65%)
ceh-27NP_001256348.1 homeodomain 99..157 CDD:238039 39/57 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24340
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.