DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and Nkx2-9

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_032727.2 Gene:Nkx2-9 / 18094 MGIID:1270158 Length:235 Species:Mus musculus


Alignment Length:175 Identity:80/175 - (45%)
Similarity:99/175 - (56%) Gaps:25/175 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 TDMRNSASWYGSTANDPRFAISRLMSSSASGTMSHMGNMSGLAACSVSDSKPLQFPLAQRRKRRV 258
            |.:..:|:|..|..       |..:||..||..:...:.|.||  |:....|...| .:||||||
Mouse    32 TCVPQTAAWLESEC-------SHYLSSDESGLETSPADSSQLA--SLRRESPGSDP-EKRRKRRV 86

  Fly   259 LFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKCKR-------QAKEKA 316
            ||::||..||||||:|||||||||||.||.|:.||||||||||||||||.||       :..:.|
Mouse    87 LFSKAQTLELERRFRQQRYLSAPEREQLARLLRLTPTQVKIWFQNHRYKLKRGRAPGITEPSDMA 151

  Fly   317 MAEQNQHNQPASSPRRVAVPVLVKDGKPCSGNNSSSQSQQHGTNS 361
             |..:.|..|... |||.|||||.|..|      |:..:..||::
Mouse   152 -ASSDLHAAPGLL-RRVVVPVLVHDRPP------SNNGRGEGTSA 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 43/52 (83%)
Nkx2-9NP_032727.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..86 13/37 (35%)
Homeobox 84..138 CDD:365835 43/53 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833334
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.