DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and unc-30

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001021277.1 Gene:unc-30 / 178265 WormBaseID:WBGene00006766 Length:323 Species:Caenorhabditis elegans


Alignment Length:413 Identity:85/413 - (20%)
Similarity:127/413 - (30%) Gaps:132/413 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 DTLIHTAISQHHQVDTSTKLNTNETSTQNTVSTAAAAAVAHHHHNLSSIHHLQNLHSQHQSTLFN 109
            :|...|||.|..|             :.|..|..........||:|...|.:.:..:......:.
 Worm     4 NTATLTAIHQQQQ-------------SHNRFSNPLVCVGQLDHHSLLPEHSISSSLAPLTHNPYA 55

  Fly   110 SNHSTPFSVTDILSPIEESYRKLELNGNPPSPFRSNSSSSSINSPGTLTTSTMANPYAMGTLYHS 174
            .|:|.|...|||.:.:.    ||||         .:...........|.||:             
 Worm    56 FNYSIPLPPTDITTKLP----KLEL---------LSLDVKQEQDDNHLDTSS------------- 94

  Fly   175 PGVQTYCGPTDNLSLAGHYTDMRNSASWYGSTANDPRFAISRLMSSSASGTMSHMGNMSGLAACS 239
                    |||                   ||.|                     |:.:|     
 Worm    95 --------PTD-------------------STGN---------------------GSTNG----- 106

  Fly   240 VSDSKPLQFPLAQRRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNH 304
                ..:|.|    |::|..||..|:.|||..|.:.||.....||.:|..|.||..:|::||:|.
 Worm   107 ----GKIQKP----RRQRTHFTSHQLTELENWFSRNRYPDMACREEIAVWISLTEPRVRVWFKNR 163

  Fly   305 RYKCKR----------QAKEKAMAEQNQHNQPASSPRRVAVPVLVKDGKPCSGNNSSSQSQQHGT 359
            |.|.::          |...|..|   |...|..|.:......|::.......:::.:.|..:|.
 Worm   164 RAKWRKRERNYVIDNGQGTTKVTA---QSLDPLGSLQNTFPQTLLQSSSSQLDDSAVTSSSFYGY 225

  Fly   360 NSTSAGNNTGSANNGNANSGIV----------------SVTANVSGGLNLI---TGDAPNSHSPD 405
            ......|...|.||....:..:                :.|:..|...||.   |..|..|.|..
 Worm   226 GGAWQQNPYYSRNNQTTFNWQIKPQDQFQFQTIPMSPTTATSRFSTAANLAPLPTAQAAFSTSAT 290

  Fly   406 TSSSLLASYGTVGGSNVAMLQQP 428
            :|:..|.....:..|..:.|.||
 Worm   291 SSNDKLKLMDGLSNSLSSSLGQP 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 22/52 (42%)
unc-30NP_001021277.1 Homeobox 116..168 CDD:278475 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I4000
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.