DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and Lbx2

DIOPT Version :10

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_034822.1 Gene:Lbx2 / 16815 MGIID:1342288 Length:195 Species:Mus musculus


Alignment Length:210 Identity:58/210 - (27%)
Similarity:78/210 - (37%) Gaps:70/210 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 NSNHS--TPFSVTDILSP--IEESYRKLELNGNPPSPFRSNSSSSSINSPGTLTTSTMANPYAMG 169
            ||.|.  ||||:.|||.|  :.|:....:|....|.|      :|.:.:...|.:.|.       
Mouse     2 NSVHQRRTPFSIADILGPSMVPEAPSAPQLPEAGPDP------ASPLCALEELASKTF------- 53

  Fly   170 TLYHSPGVQTYCGPTDNLSLAGHYTDMRNSASWYGSTANDPRFAISRLMSSSASGTMSHMGNMSG 234
             |.|||..                               .|:.:..|....:..|..:       
Mouse    54 -LGHSPRA-------------------------------TPQPSEGRAAPEAPPGPGA------- 79

  Fly   235 LAACSVSDSKPLQFPLAQRRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKI 299
                          .:.:|||.|..||..||.||||||..|:||:..||:.||:.:.|...||..
Mouse    80 --------------GVRRRRKSRTAFTAQQVLELERRFVFQKYLAPSERDGLAARLGLANAQVVT 130

  Fly   300 WFQNHRYKCKRQAKE 314
            ||||.|.|.||..:|
Mouse   131 WFQNRRAKLKRDVEE 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeodomain 254..310 CDD:459649 29/55 (53%)
Lbx2NP_034822.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..89 28/152 (18%)
Homeodomain 85..141 CDD:459649 29/55 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 164..195
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.