DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and NKX6-3

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001351770.1 Gene:NKX6-3 / 157848 HGNCID:26328 Length:265 Species:Homo sapiens


Alignment Length:248 Identity:67/248 - (27%)
Similarity:101/248 - (40%) Gaps:67/248 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 TPFSVTDILS-PIEESYRKLELNGNPPSPFRSNSSSSSINSPGTLTTSTMANPYAMGTLYHSPGV 177
            ||..:||||| |:......| |:|.|     ..:....::|.|               :|:||.|
Human    51 TPHGITDILSRPVAAPNNSL-LSGYP-----HVAGFGGLSSQG---------------VYYSPQV 94

  Fly   178 QTYCGPTDNLSLAGHYTDMRNSASWYGSTANDPRFAISRLMSSSASGTMSHMGNMSGLAACSVSD 242
                   .|.|.||:....|....| ..|..|.|                      |...|| :.
Human    95 -------GNFSKAGNEYPTRTRNCW-ADTGQDWR----------------------GGRQCS-NT 128

  Fly   243 SKPLQFPLAQRRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYK 307
            ..||...:.:::..|..||..|::.||:.|:|.:||:.|||..||..:.:|.:|||:||||.|.|
Human   129 PDPLSDSIHKKKHTRPTFTGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTK 193

  Fly   308 CKRQAKEKAMAEQNQHNQPASSPRRVAVPVLVKDGKPCSGNNSSSQSQQHGTN 360
            .:   |:.|:       :|:||..|.....    |....|:.:.|:::....|
Human   194 WR---KKSAL-------EPSSSTPRAPGGA----GAGAGGDRAPSENEDDEYN 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 25/52 (48%)
NKX6-3NP_001351770.1 Homeobox 142..195 CDD:306543 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143163
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.