DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and Hoxa4

DIOPT Version :10

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_032291.1 Gene:Hoxa4 / 15401 MGIID:96176 Length:285 Species:Mus musculus


Alignment Length:79 Identity:31/79 - (39%)
Similarity:42/79 - (53%) Gaps:2/79 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 RKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKCKRQAK--EKA 316
            ::.|..:|:.||.|||:.|...|||:...|..:|..:.|:..||||||||.|.|.|:..|  ...
Mouse   181 KRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKWKKDHKLPNTK 245

  Fly   317 MAEQNQHNQPASSP 330
            |...|..:.||..|
Mouse   246 MRSSNTASAPAGPP 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeodomain 254..310 CDD:459649 24/55 (44%)
Hoxa4NP_032291.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..70
PHA03247 <43..161 CDD:223021
Antp-type hexapeptide 159..164
Homeodomain 181..237 CDD:459649 24/55 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..285 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.