DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and NKX2-5

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_004378.1 Gene:NKX2-5 / 1482 HGNCID:2488 Length:324 Species:Homo sapiens


Alignment Length:337 Identity:111/337 - (32%)
Similarity:151/337 - (44%) Gaps:80/337 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 TPFSVTDILSPIEESYRKLELNGNPPSPFRSNSSSSSINSPGTLTTSTMANPYAMGTLYHSPGVQ 178
            |||||.|||: :|:..|.|...|...:...:..:.||     .:..:.....|| |....:||: 
Human    10 TPFSVKDILN-LEQQQRSLAAAGELSARLEATLAPSS-----CMLAAFKPEAYA-GPEAAAPGL- 66

  Fly   179 TYCGPTDNLSLAGHYTDMRNSASWYGST-------------ANDPRFAISRLMSSSASGTMSHMG 230
                |.....| |........||.:.:.             |.|||.....|.:           
Human    67 ----PELRAEL-GRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCA----------- 115

  Fly   231 NMSGLAACSVSDSKPLQFPLAQRRKR-RVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTP 294
             :........:::...:.|.|:||:: ||||:||||||||||||||||||||||:.|||::.||.
Human   116 -LQKAVELEKTEADNAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTS 179

  Fly   295 TQVKIWFQNHRYKCKRQAKEKAMAEQNQHNQPASSPRRVAVPVLVKDGKPCSGNNSSSQSQQHGT 359
            |||||||||.|||||||.:::.:........|....||:||||||:|||||.| :|:..:..:|.
Human   180 TQVKIWFQNRRYKCKRQRQDQTLELVGLPPPPPPPARRIAVPVLVRDGKPCLG-DSAPYAPAYGV 243

  Fly   360 NSTSAGNN---------------------------------TGSANNGNANSGIVSVTANVSGGL 391
            .....|.|                                 |.:|||...|.|:..:.|..|.|:
Human   244 GLNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDLNAVQSPGI 308

  Fly   392 NLITGDAPNSHS 403
                   |.|:|
Human   309 -------PQSNS 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 43/53 (81%)
NKX2-5NP_004378.1 Homeobox 145..194 CDD:278475 40/48 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143184
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.